CAZyme Information: MGYG000003708_02348

Basic Information

• Species: Sedimentibacter sp003457065
• Lineage: Bacteria; Firmicutes_A; Clostridia; Tissierellales; Sedimentibacteraceae; Sedimentibacter; Sedimentibacter sp003457065
• CAZyme ID: MGYG000003708_02348
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
253		29460.82	5.3377

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003708	3113700	MAG	Russia	Europe

• Gene Location: Start: 1755; End: 2516 Strand: -

Full Sequence      

MQAYINGGFEYTVQVGDTLWLIAQRFHTTTEAILLENPMLDGNNLYIGQIIRIPQSSRYN
PMTSRCFSNCISREEQMLSNQFRLLWEQHVYWTRMVILSIVFGLPDIEYVTNRLLRNPKD
FARLLGLFYGEDVVSNFVNLFTKHLTIAAELVKASKDGDNAAAANAEKRWYANADQIAEF
FARINPYWSEQTWKKLLYDHLAMTKDEAIYMLTQKYADSINIFDKIEQEALIMADTMTQG
IVKLFPHYMCIFD

Enzyme Prediction     

No EC number prediction in MGYG000003708_02348.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00118	LysM	4.07e-13	11	53	3	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
smart00257	LysM	1.25e-12	10	53	1	44	Lysin motif.
pfam01476	LysM	4.37e-12	11	54	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
COG1388	LysM	2.01e-09	11	64	69	121	LysM repeat [Cell wall/membrane/envelope biogenesis].
PRK11198	PRK11198	2.78e-06	11	55	98	147	LysM domain/BON superfamily protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMJ41140.1	1.29e-108	1	243	1	240
QDX95442.1	3.94e-84	1	247	1	253
AYB38817.1	6.83e-81	9	246	9	252
CDZ24510.1	1.16e-80	11	245	11	243
SET90038.1	2.87e-72	6	248	457	764

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5K2L_A	1.15e-07	8	54	2	48	Crystalstructure of LysM domain from Volvox carteri chitinase [Volvox carteri f. nagariensis],5YZK_A Solution structure of LysM domain from a chitinase derived from Volvox carteri [Volvox carteri f. nagariensis]
5YZ6_A	2.19e-07	8	54	2	48	Solutionstructure of LysM domain from a chitinase derived from Volvox carteri [Volvox carteri f. nagariensis]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003708_02348.