CAZyme Information: MGYG000003709_02157

Basic Information

• Species: Enterococcus_A devriesei
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus_A; Enterococcus_A devriesei
• CAZyme ID: MGYG000003709_02157
• CAZy Family: GH65
• CAZyme Description: Maltose phosphorylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
274		31760.77	4.5062

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003709	3054497	MAG	Russia	Europe

• Gene Location: Start: 3371; End: 4195 Strand: -

Full Sequence      

MCIRDSWYTNYIASWVLSYTLENYNKYQAQATVTITPEEQAKWQDIIDRMYYPTDEELGI
FVQHDTFLDKDLMPTSELDPAERPLNQHWSWDKILRSCFIKQADVLQGIYYFGDQFTLEE
KRKNFEFYEPMTVHESSLSASVHSILAAELGLTDKSMEMYQRTARLDLDNYNNDTDDGLH
ITSMTGSWLAIVHGFAQMKTSTGELSFAPILPKEWENYSFHVNYRGRLLAVAVNQKEVTI
DLKDGPALAMMLYGKEITLENTLTVSLKQEESHV

Enzyme Prediction     

EC	2.4.1.8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH65	3	201	1.2e-71	0.5349462365591398

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13807	PRK13807	1.09e-178	7	267	494	756	maltose phosphorylase; Provisional
COG1554	ATH1	7.27e-119	3	271	499	772	Trehalose and maltose hydrolase (possible phosphorylase) [Carbohydrate transport and metabolism].
pfam03632	Glyco_hydro_65m	7.30e-96	3	205	181	387	Glycosyl hydrolase family 65 central catalytic domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. The central domain is the catalytic domain, which binds a phosphate ion that is proximal the the highly conserved Glu. The arrangement of the phosphate and the glutamate is thought to cause nucleophilic attack on the anomeric carbon atom. The catalytic domain also forms the majority of the dimerization interface.
pfam03633	Glyco_hydro_65C	2.90e-17	209	258	1	50	Glycosyl hydrolase family 65, C-terminal domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. The C-terminal domain forms a two layered jelly roll motif. This domain is situated at the base of the catalytic domain, however its function remains unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QZO09764.1	6.70e-166	3	274	490	761
QCQ12899.1	1.34e-165	3	274	490	761
QXJ60207.1	1.90e-165	3	274	490	761
AYQ24305.1	1.90e-165	3	274	490	761
BBM18925.1	6.95e-163	3	274	490	761

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1H54_A	8.73e-93	3	260	492	742	ChainA, Maltose Phosphorylase [Levilactobacillus brevis],1H54_B Chain B, Maltose Phosphorylase [Levilactobacillus brevis]
3WIQ_A	1.75e-32	8	240	493	736	Crystalstructure of kojibiose phosphorylase complexed with kojibiose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_A Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_B Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_C Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_D Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903]
4KTP_A	7.57e-26	20	261	503	754	ChainA, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTP_B Chain B, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10]
4KTR_A	7.57e-26	20	261	503	754	ChainA, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_B Chain B, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_C Chain C, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_D Chain D, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_E Chain E, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_F Chain F, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_G Chain G, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_H Chain H, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E6ENP7	1.28e-128	3	274	512	783	Maltose phosphorylase OS=Enterococcus faecalis (strain TX4000 / JH2-2) OX=749493 GN=malP PE=1 SV=1
O06993	2.74e-111	3	260	488	747	Maltose phosphorylase OS=Bacillus subtilis (strain 168) OX=224308 GN=mdxK PE=3 SV=1
Q8L164	5.51e-57	3	260	503	769	Alpha,alpha-trehalose phosphorylase OS=Thermoanaerobacter brockii OX=29323 GN=treP PE=1 SV=1
Q8GRC3	8.94e-48	3	266	484	758	Alpha,alpha-trehalose phosphorylase OS=Geobacillus stearothermophilus OX=1422 GN=treP PE=1 SV=1
Q8L163	2.06e-34	3	260	506	775	Kojibiose phosphorylase OS=Thermoanaerobacter brockii OX=29323 GN=kojP PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003709_02157.