CAZyme Information: MGYG000003711_00777

Basic Information

• Species: Stenotrophomonas maltophilia_AQ
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Xanthomonadales; Xanthomonadaceae; Stenotrophomonas; Stenotrophomonas maltophilia_AQ
• CAZyme ID: MGYG000003711_00777
• CAZy Family: GH104
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
166		18334.24	10.5238

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003711	4541486	MAG	Estonia	Europe

• Gene Location: Start: 32996; End: 33496 Strand: -

Full Sequence      

MRRSLNAGAQYDWPFVCVQVVFDSVLAEKCGLARALRRAAQAGDLVPGQVHVRRHADHPR
VLVDLPKLKIQSTAAGRYQLLRRYYDAYKKTLGLKDFAPLSQDLIAPQQIRERHALPLIQ
AGKIPEAIGRVRNIWASLPGAGYGQHEHAPADLLAVYRKAGGTVAP

Enzyme Prediction     

EC	4.2.2.N1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH104	44	161	1.2e-38	0.8

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00736	lambda_lys-like	1.82e-52	56	162	35	141	Bacteriophage lambda lysozyme and similar proteins. Lysozyme from bacteriophage lambda hydrolyzes the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetylglucosamine (GlcNAc), as do other lysozymes. However, unlike other lysozymes, bacteriophage lambda does not produce a reducing end upon cleavage of the peptidoglycan, but rather uses the 6-OH of the same MurNAc residue to produce a 1,6-anhydromuramic acid terminal residue and is therefore a lytic transglycosylase. An identical 1,6-anhydro bond is formed in bacterial peptidoglycans by the action of the lytic transglycosylases of E. coli, though they differ structurally.
COG4678	COG4678	3.38e-42	45	165	58	179	Muramidase (phage lambda lysozyme) [Cell wall/membrane/envelope biogenesis, Mobilome: prophages, transposons].
pfam00959	Phage_lysozyme	2.82e-09	63	148	13	104	Phage lysozyme. This family includes lambda phage lysozyme and E. coli endolysin.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDY47394.1	7.73e-69	20	166	15	162
QDY50427.1	7.73e-69	20	166	15	162
ACF52212.1	1.81e-67	20	166	15	162
ARQ90486.1	3.65e-67	20	166	15	162
QQQ44131.1	2.10e-66	20	166	15	162

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1D9U_A	9.59e-43	22	164	11	153	ChainA, Bacteriophage Lambda Lysozyme [Lambdavirus lambda],1D9U_B Chain B, Bacteriophage Lambda Lysozyme [Lambdavirus lambda],3D3D_A Chain A, Lysozyme [Lambdavirus lambda],3D3D_B Chain B, Lysozyme [Lambdavirus lambda]
1AM7_A	2.85e-40	22	164	11	153	ChainA, LYSOZYME [Lambdavirus lambda],1AM7_B Chain B, LYSOZYME [Lambdavirus lambda],1AM7_C Chain C, LYSOZYME [Lambdavirus lambda]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P03706	5.92e-42	22	164	11	153	Endolysin OS=Escherichia phage lambda OX=10710 GN=R PE=1 SV=1
P51771	4.32e-30	71	165	71	165	Endolysin OS=Escherichia phage P2 OX=10679 GN=K PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003711_00777.