CAZyme Information: MGYG000003711_02133

Basic Information

• Species: Stenotrophomonas maltophilia_AQ
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Xanthomonadales; Xanthomonadaceae; Stenotrophomonas; Stenotrophomonas maltophilia_AQ
• CAZyme ID: MGYG000003711_02133
• CAZy Family: AA3
• CAZyme Description: Oxygen-dependent choline dehydrogenase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
560	MGYG000003711_49|CGC1	61635.69	7.5904

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003711	4541486	MAG	Estonia	Europe

• Gene Location: Start: 14175; End: 15857 Strand: +

Full Sequence      

MSTHNEYDYIIIGAGSAGNVLATRLTEDADVSVLLLEAGGPDYRLDFRTQMPAALAFPLQ
GKRYNWAYKTDPEPFMNNRRMDCGRGKGLGGSSLINGMCYIRGNAMDYDNWASMPGLDDW
TYLDCLPYFRKAETRDIGPNDYHGGDGPLRVTTPKAGNNELFAAMVEAGVQAGYPRTDDL
NGYQQEGFGPMDRTVTPKGRRSSTARGYLDLAKPRPNLTIVTHALTDRILFSGKRAVGVQ
WLHNDQPQRATARREVLLCGGAIASPQILQRSGVGPADLLRSLDIDLVHHLPGVGANLQD
HLEMYLQYECKKPVSLAPALKLYNQPAIGAEWLFLGTGIGASNQFEAGGFIRSDAEFDWP
NLQYHFLPVAINYNGSNPIKAHSFQMHVGSMRSPSRGRIHVRSKDPREHPSILFNYMSHD
QDWREFRAAIRITREIFAQPALAPYSGREISPGSALQTDAQIDAFVREHAETAYHPSCSN
KMGHADDPMAVVDGQGRVHGLEGLRIVDASIMPQVVTGNLNAPTIMIAEKLADVIRGRTP
LARSTAPYYKANGAPVRSKG

Enzyme Prediction     

No EC number prediction in MGYG000003711_02133.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	6	536	2.7e-163	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2303	BetA	0.0	4	543	5	541	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
PRK02106	PRK02106	0.0	2	557	1	553	choline dehydrogenase; Validated
TIGR01810	betA	0.0	8	541	1	532	choline dehydrogenase. Choline dehydrogenase catalyzes the conversion of exogenously supplied choline into the intermediate glycine betaine aldehyde, as part of a two-step oxidative reaction leading to the formation of osmoprotectant betaine. This enzymatic system can be found in both gram-positive and gram-negative bacteria. As in Escherichia coli, Staphylococcus xylosus, and Sinorhizobium meliloti, this enzyme is found associated in a transciptionally co-induced gene cluster with betaine aldehyde dehydrogenase, the second catalytic enzyme in this reaction. Other gram-positive organisms have been shown to employ a different enzymatic system, utlizing a soluable choline oxidase or type III alcohol dehydrogenase instead of choline dehydrogenase. This enzyme is a member of the GMC oxidoreductase family (pfam00732 and pfam05199), sharing a common evoluntionary origin and enzymatic reaction with alcohol dehydrogenase. Outgrouping from this model, Caulobacter crescentus shares sequence homology with choline dehydrogenase, yet other genes participating in this enzymatic reaction have not currently been identified. [Cellular processes, Adaptations to atypical conditions]
pfam00732	GMC_oxred_N	1.28e-63	77	303	15	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
pfam05199	GMC_oxred_C	3.24e-43	395	531	3	143	GMC oxidoreductase. This domain found associated with pfam00732.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWP09430.1	1.07e-190	6	550	19	565
ANI26486.1	8.37e-190	6	550	70	616
CAB3230510.1	1.17e-188	2	549	20	569
CAG5089487.1	7.49e-164	7	557	17	580
CAG5086058.1	3.67e-160	6	552	14	580

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YRU_AAA	1.00e-82	6	546	7	571	ChainAAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6ZH7_A	1.00e-82	6	546	7	571	ChainA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YS1_AAA	1.40e-82	6	546	7	571	ChainAAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
5NCC_A	1.47e-82	6	546	23	587	Structureof Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]
6YS2_AAA	1.97e-82	6	546	7	571	ChainAAA, Fatty acid Photodecarboxylase [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1CFR7	0.0	6	558	2	554	Oxygen-dependent choline dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Nepal516) OX=377628 GN=betA PE=3 SV=1
Q4ZM63	0.0	1	559	1	559	Oxygen-dependent choline dehydrogenase OS=Pseudomonas syringae pv. syringae (strain B728a) OX=205918 GN=betA PE=3 SV=1
Q4K4K7	0.0	6	559	4	557	Oxygen-dependent choline dehydrogenase OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=betA PE=3 SV=1
Q48CM7	0.0	1	559	1	559	Oxygen-dependent choline dehydrogenase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) OX=264730 GN=betA PE=3 SV=1
Q66D54	0.0	6	558	2	554	Oxygen-dependent choline dehydrogenase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) OX=273123 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000010	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003711_02133.