CAZyme Information: MGYG000003712_00295

Basic Information

• Species: Serratia liquefaciens
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Serratia; Serratia liquefaciens
• CAZyme ID: MGYG000003712_00295
• CAZy Family: GT51
• CAZyme Description: Biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
243		27536.98	10.7766

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003712	5062001	MAG	Estonia	Europe

• Gene Location: Start: 82845; End: 83576 Strand: -

Full Sequence      

MRKSVGKSMLSRPWFWLKRGLIAVVGAWLLGILVFAFLPVPFSAVMVERQIGAWLRGDFG
YVAHSDWVSMDEISPQMALAVMAAEDQKFPDHWGFDVAAIEKAFSHNERRPTRIRGASTL
SQQTAKNLFLWDGRSWLRKGLEAGLTSGIELVWTKRRILTVYLNIVEFGDGVFGVEEASR
RYFNKPAKRLTASEAALLAAVLPNPHRFKANAPSGYVIQRQQWIMRQMRQLGGEGFLKEN
KLD

Enzyme Prediction     

EC	2.4.1.129

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	62	229	1e-55	0.943502824858757

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00056	mtgA	1.41e-147	7	241	2	236	monofunctional biosynthetic peptidoglycan transglycosylase; Provisional
TIGR02070	mono_pep_trsgly	2.77e-93	15	234	1	224	monofunctional biosynthetic peptidoglycan transglycosylase. This family is one of the transglycosylases involved in the late stages of peptidoglycan biosynthesis. Members tend to be small, about 240 amino acids in length, and consist almost entirely of a domain described by pfam00912 for transglycosylases. Species with this protein will have several other transglycosylases as well. All species with this protein are Proteobacteria that produce murein (peptidoglycan). [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	2.98e-82	1	233	8	245	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	1.15e-69	61	229	9	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
TIGR02074	PBP_1a_fam	3.23e-44	67	232	4	169	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGQ32995.1	4.16e-178	1	243	1	243
QNQ53896.1	4.16e-178	1	243	1	243
QDL35123.1	4.16e-178	1	243	1	243
QIC88964.1	4.16e-178	1	243	1	243
QHT52896.1	1.19e-177	1	243	1	243

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OQO_A	6.01e-28	67	232	22	187	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	2.34e-27	67	232	22	187	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
4OON_A	3.24e-22	55	232	30	206	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
3UDF_A	2.55e-19	68	232	42	206	ChainA, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDF_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii]
7U4H_A	3.67e-19	68	208	43	181	ChainA, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX],7U4H_B Chain B, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B1JL77	3.83e-138	10	243	8	241	Biosynthetic peptidoglycan transglycosylase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) OX=502800 GN=mtgA PE=3 SV=1
Q3V7N9	5.43e-138	10	243	8	241	Biosynthetic peptidoglycan transglycosylase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) OX=273123 GN=mtgA PE=3 SV=1
B2K3Y6	5.43e-138	10	243	8	241	Biosynthetic peptidoglycan transglycosylase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) OX=502801 GN=mtgA PE=3 SV=1
Q1CE18	1.56e-137	11	243	9	241	Biosynthetic peptidoglycan transglycosylase OS=Yersinia pestis bv. Antiqua (strain Nepal516) OX=377628 GN=mtgA PE=3 SV=1
Q1C1G0	1.56e-137	11	243	9	241	Biosynthetic peptidoglycan transglycosylase OS=Yersinia pestis bv. Antiqua (strain Antiqua) OX=360102 GN=mtgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000031	0.000022	0.000000	0.000000	0.000000	0.000005

TMHMM  Annotations     

start	end
20	42