CAZyme Information: MGYG000003712_00783

Basic Information

• Species: Serratia liquefaciens
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Serratia; Serratia liquefaciens
• CAZyme ID: MGYG000003712_00783
• CAZy Family: GH24
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
171	MGYG000003712_10|CGC1	18171.9	9.079

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003712	5062001	MAG	Estonia	Europe

• Gene Location: Start: 23480; End: 23995 Strand: -

Full Sequence      

MSVAKKTGAAGAVCSVMVIIGLVLSSGEVKTSQAGLELIGNAEGCRRDPYKCPADVWTDG
VGNTHGVKPGVRKTDQQIAADWKKNIIAAEQCVNRYAAGDKLSQGAFDAAVSITFNAGCA
TMQKSTMFRLFRQGDAAAACEQFPRWVYASGVKLNGLVIRRDKERALCLAN

Enzyme Prediction     

No EC number prediction in MGYG000003712_00783.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH24	32	164	1.1e-41	0.9854014598540146

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16901	lyz_P1	1.73e-83	31	169	2	140	P1 lysozyme Lyz-like proteins. Enterobacteria phage P1 lysozyme Lyz is secreted to the Escherichia coli periplasm where it is membrane bound and inactive. Activation involves the release from the membrane, an intramolecular thiol-disulfide isomerization and extensive structural rearrangement of the N-terminal region. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
cd00737	lyz_endolysin_autolysin	1.40e-48	35	169	1	136	endolysin and autolysin. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
COG3772	RrrD	1.31e-47	31	169	7	148	Phage-related lysozyme (muramidase), GH24 family [Cell wall/membrane/envelope biogenesis].
pfam00959	Phage_lysozyme	1.03e-31	56	162	1	107	Phage lysozyme. This family includes lambda phage lysozyme and E. coli endolysin.
cd16900	endolysin_R21-like	8.42e-31	38	169	11	142	endolysin R21-like proteins. Unlike T4 E phage lysozyme, the endolysin R21 from Enterobacteria phage P21 has an N-terminal SAR (signal-arrest-release) domain that anchors the endolysin to the membrane in an inactive form, which act to prevent premature lysis of the infected bacterium. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAO33310.1	1.91e-109	1	170	1	170
AWQ49193.1	2.23e-108	1	170	1	170
QHC46388.1	4.49e-108	1	169	1	169
AVE52011.1	1.29e-107	1	170	1	170
ASM16278.1	1.83e-107	1	170	1	170

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XJT_A	4.64e-60	5	169	4	179	ChainA, Lysozyme [Punavirus P1]
1XJU_A	1.59e-54	30	169	1	151	ChainA, Lysozyme [Punavirus P1],1XJU_B Chain B, Lysozyme [Punavirus P1]
6ET6_A	3.83e-20	24	169	45	194	ChainA, Lysozyme [Acinetobacter baumannii]
3HDF_A	4.49e-15	43	169	10	136	ChainA, Lysozyme [Enterobacteria phage P21],3HDF_B Chain B, Lysozyme [Enterobacteria phage P21]
3HDE_A	7.68e-15	43	169	35	161	ChainA, Lysozyme [Enterobacteria phage P21],3HDE_B Chain B, Lysozyme [Enterobacteria phage P21],3HDE_C Chain C, Lysozyme [Enterobacteria phage P21],3HDE_D Chain D, Lysozyme [Enterobacteria phage P21]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q37875	1.28e-60	5	169	4	179	SAR-endolysin OS=Escherichia phage P1 OX=2886926 GN=17 PE=1 SV=1
P51728	8.89e-33	30	169	34	184	SAR-endolysin OS=Haemophilus phage HP1 (strain HP1c1) OX=1289570 GN=lys PE=3 SV=1
O80292	1.97e-16	43	169	37	163	SAR-endolysin OS=Bacteriophage PS119 OX=83128 GN=19 PE=3 SV=1
P27359	3.00e-14	43	169	35	161	SAR-endolysin OS=Enterobacteria phage P21 OX=10711 GN=R PE=1 SV=1
P78285	4.20e-14	43	169	35	161	Lysozyme RrrD OS=Escherichia coli (strain K12) OX=83333 GN=rrrD PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000318	0.999100	0.000152	0.000140	0.000125	0.000124

TMHMM  Annotations     

start	end
7	29