CAZyme Information: MGYG000003712_00873

Basic Information

• Species: Serratia liquefaciens
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Serratia; Serratia liquefaciens
• CAZyme ID: MGYG000003712_00873
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
382		42264.51	7.9141

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003712	5062001	MAG	Estonia	Europe

• Gene Location: Start: 37177; End: 38325 Strand: +

Full Sequence      

MQNRPLTIGLVAGETSGDILGAGLIRALKAQVPDARFVGVAGPLMQAEGCETWYEMEELA
VMGVVEVLERLPRLLKIRKDLTRRFSDLKPDVFVGIDAPDFNITLEGRLKQHGIRTIHYV
SPSVWAWRQKRVFKIGKATDLVLAFLPFEKAFYDRFNVPCRFIGHTMADAMPLQADKLAA
RATLGIAPDARCLALLPGSRSAEVEMLSADFLKTAQLLRTRYPDLELVVPLVNAKRREQF
ERIKAEVAPELRVHLLNGQGREAMVASDAALLASGTAALECMLAKCPMVVGYRMKPFTFW
LAQRLVKTPYVSLPNLLAGREIVTELLQHDCVPDKLAAAVMPLLEDGPQTDELKQTFLTL
HQSIRCGADEQAAQAVLELAKA

Enzyme Prediction     

No EC number prediction in MGYG000003712_00873.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	8	365	1.4e-140	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR00215	lpxB	0.0	1	379	1	385	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
COG0763	LpxB	0.0	5	382	1	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
PRK00025	lpxB	0.0	5	381	1	376	lipid-A-disaccharide synthase; Reviewed
pfam02684	LpxB	2.02e-180	8	376	1	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
PRK01021	lpxB	3.16e-55	10	340	231	566	lipid-A-disaccharide synthase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIC88546.1	1.28e-276	1	382	1	382
QHT52477.1	1.28e-276	1	382	1	382
AKE09066.1	1.28e-276	1	382	1	382
AGQ32576.1	5.22e-276	1	382	1	382
AMH00808.1	1.05e-275	1	382	1	382

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	2.22e-221	2	381	3	382	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	1.82e-220	2	381	3	382	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A8GID3	4.36e-269	1	382	1	382	Lipid-A-disaccharide synthase OS=Serratia proteamaculans (strain 568) OX=399741 GN=lpxB PE=3 SV=1
Q6D8D0	6.40e-237	1	379	1	379	Lipid-A-disaccharide synthase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) OX=218491 GN=lpxB PE=3 SV=1
C6DAJ6	1.06e-235	1	381	1	381	Lipid-A-disaccharide synthase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) OX=561230 GN=lpxB PE=3 SV=1
Q667K2	2.63e-234	4	380	16	392	Lipid-A-disaccharide synthase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) OX=273123 GN=lpxB PE=3 SV=1
Q8ZH55	2.63e-234	4	380	16	392	Lipid-A-disaccharide synthase OS=Yersinia pestis OX=632 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000023	0.000006	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003712_00873.