CAZyme Information: MGYG000003712_01115

Basic Information

• Species: Serratia liquefaciens
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Serratia; Serratia liquefaciens
• CAZyme ID: MGYG000003712_01115
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
476	MGYG000003712_16|CGC1	53729.52	5.1287

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003712	5062001	MAG	Estonia	Europe

• Gene Location: Start: 16002; End: 17432 Strand: -

Full Sequence      

MSDSTFPQGFLWGGALAANQSEGGYREGGKGLTTVDMIPHGPNRMPVKLGLEKRFTLRED
EFYPSHDAIDFYHRYRDDIALMAEMGFSVFRTSIAWSRIYPNGDELTPNPEGIAFYRSLF
EECRKYGIEPLVTLCHFDVPMHLVTEYGSWRSRKMVEFFTRYARTCFEAFDGLVKYWLTF
NEINIVLHSPFSGAGLVFEAGENPEQVKYQAVHHELVASALATRIAHEVNPANQVGCMLA
GGNFYPWSSKPEDMWAALEKDRENLFFIDVQARGAYPSYSARVFREKGVSIVMEEGDAEI
LKNTVDFVSFSYYASRCASADMNDNNSSAANVVKSLTNPHIPRSDWGWGIDPLGLRITMN
MMYDRYQKPLFLVENGLGAHDEFNADGEIADDYRISYLREHIRAMADAIADGVPVMGYTT
WGCIDLVAASTGEMSKRYGLVYVDRDDNGNGTLARTRKKSFWWYKQVIASNGGDLG

Enzyme Prediction     

EC	3.2.1.86	3.2.1.21	3.2.1.37

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	4	472	1.3e-149	0.9906759906759907

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09589	celA	0.0	4	475	2	476	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	0.0	3	476	1	474	cryptic 6-phospho-beta-glucosidase; Provisional
PRK15014	PRK15014	0.0	1	475	1	477	6-phospho-beta-glucosidase BglA; Provisional
COG2723	BglB	0.0	4	472	2	454	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	0.0	5	475	5	477	6-phospho-beta-glucosidase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNQ54883.1	0.0	1	476	1	476
AGQ29293.1	0.0	1	476	1	476
AMG99446.1	0.0	1	476	1	476
QIC85325.1	0.0	1	476	1	476
QDL34107.1	0.0	1	476	1	476

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	2.07e-201	6	475	8	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
4IPL_A	1.93e-174	6	475	20	485	Thecrystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPL_B The crystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_B The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_E The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4]
2XHY_A	2.95e-174	5	475	7	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
4F66_A	8.69e-169	4	475	5	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	2.47e-168	4	475	5	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P24240	1.50e-314	4	475	2	473	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
P40740	1.71e-202	2	475	4	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
Q48409	2.12e-192	5	475	3	462	Phospho-cellobiase OS=Klebsiella oxytoca OX=571 GN=casB PE=3 SV=1
Q46130	3.42e-186	3	475	4	471	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
P11988	4.09e-184	6	475	4	462	6-phospho-beta-glucosidase BglB OS=Escherichia coli (strain K12) OX=83333 GN=bglB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003712_01115.