CAZyme Information: MGYG000003712_01953

Basic Information

• Species: Serratia liquefaciens
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Serratia; Serratia liquefaciens
• CAZyme ID: MGYG000003712_01953
• CAZy Family: GH23
• CAZyme Description: Endo-type membrane-bound lytic murein transglycosylase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
215	MGYG000003712_37|CGC2	23775.33	8.4535

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003712	5062001	MAG	Estonia	Europe

• Gene Location: Start: 22441; End: 23088 Strand: +

Full Sequence      

MMPTFIPAKTIRSTMKPTLRHWSRAGVICLMLILAGCSSKKPRTSYDAHAFDDAIEDAAD
KYDVDQKLIAAMIKVESGFNPAAISRSNAIGLMQLKADTAGCDAYRYKGKRGCPDDDDLL
DPDTNIDLGAAYLAVLQKQQLKGIDDPVTLRYATIIAYVNGTGALLRTFSSNRQQAISMI
NNLSPEAFNWHVRKYHPAPQAPRHLMKVEAAYEQL

Enzyme Prediction     

No EC number prediction in MGYG000003712_01953.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	66	213	1.7e-21	0.7851851851851852

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16893	LT_MltC_MltE	6.84e-71	53	213	1	162	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda
PRK15470	emtA	4.68e-63	30	215	9	203	membrane-bound lytic murein transglycosylase EmtA.
PRK11671	mltC	1.07e-50	48	211	189	352	membrane-bound lytic murein transglycosylase MltC.
COG0741	MltE	6.37e-23	48	206	136	287	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
pfam01464	SLT	6.32e-21	58	178	4	112	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEI74269.1	4.50e-150	1	215	1	215
AMH00472.1	8.39e-145	15	215	1	201
QNQ53806.1	8.39e-145	15	215	1	201
AKE08765.1	8.39e-145	15	215	1	201
QDL35242.1	8.39e-145	15	215	1	201

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2Y8P_A	1.32e-51	64	215	35	186	CrystalStructure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12],2Y8P_B Crystal Structure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12]
3T36_A	1.74e-51	64	215	52	203	Crystalstructure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_B Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_C Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_D Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_E Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],4HJV_A Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_B Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_C Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_D Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_E Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12]
6GHY_A	3.76e-51	64	215	35	186	Structureof Lytic Transglycosylase MltE inactive mutant E64Q from E.coli [Escherichia coli K-12],6GHY_B Structure of Lytic Transglycosylase MltE inactive mutant E64Q from E.coli [Escherichia coli K-12]
6GHZ_A	3.76e-51	64	215	35	186	Structureof Lytic Transglycosylase MltE mutant Y192F from E.coli [Escherichia coli K-12],6GHZ_B Structure of Lytic Transglycosylase MltE mutant Y192F from E.coli [Escherichia coli K-12]
6GI3_B	3.76e-51	64	215	35	186	Structureof Lytic Transglycosylase MltE mutant S73A from E.coli [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4WBE8	9.82e-56	30	215	9	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Enterobacter sp. (strain 638) OX=399742 GN=emtA PE=3 SV=1
A7MKC3	1.12e-54	30	211	9	199	Endo-type membrane-bound lytic murein transglycosylase A OS=Cronobacter sakazakii (strain ATCC BAA-894) OX=290339 GN=emtA PE=3 SV=2
A6TAW0	9.07e-54	27	215	6	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) OX=272620 GN=emtA PE=3 SV=2
P0C960	1.82e-53	30	215	9	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Escherichia coli (strain K12) OX=83333 GN=emtA PE=1 SV=1
Q3Z2V5	1.82e-53	30	215	9	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Shigella sonnei (strain Ss046) OX=300269 GN=emtA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.035028	0.155102	0.808950	0.000744	0.000155	0.000054

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003712_01953.