CAZyme Information: MGYG000003713_00110

Basic Information

• Species: Campylobacter_B sp900539505
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Campylobacteraceae; Campylobacter_B; Campylobacter_B sp900539505
• CAZyme ID: MGYG000003713_00110
• CAZy Family: GH135
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
607		67753.22	5.8284

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003713	2118266	MAG	Finland	Europe

• Gene Location: Start: 119911; End: 121734 Strand: -

Full Sequence      

MSAADSLGAKLSRRDAASDSSASDEYENSFRIKLEYARGFAKKGSYSGRLNNQRVMMPAF
RWTGNNGVNAEFWNGITNIGGALVPYVAFGSYEAAIPGDQTTQYLVRREEDAVQMKRNIA
AGISNLGYTYTKNSTRNLNLVYADIDNFVNFYGRENIAGYFIDEVNTENNPATIAYMESI
YNYIKTKYPGMLVLANNGWGVRDAIAPYADVWMLQEVSADEYINHYRPRTSEFEKDPANS
SKILHVIYNARADQYDEIIRLSRERNAANLFITSDTNAYPSGYDDLPTYFEALMLAINNF
TPKNGSLFSQVARGGNRVGIEMPRSKVDLDLTKLARNSAYKNLTDTDGQEFNVNVSAIGN
YGGDYKDRSGGVKYDHKSDGILLGASKRVDDLTLGVIFGYQKSDAWYEGKFDGVKENIKS
YELGLAGRYDFSENVDLAVNLTYSTNDHKFETNNGFGAIHGAKYKSQIWDFSTRAGYKFL
FENGYIKPYLGLGAIRMNEDAISRLKFSSASKTAPNGTAGIYAIKAFGNLQIFANAEYEY
RFSGDSYHASRKYSDRYDVEGLDYSSGVFNGAIGLKYKIFQSIGLSASYELSESKNSLAR
AAFDVEF

Enzyme Prediction     

No EC number prediction in MGYG000003713_00110.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH135	120	293	1.1e-21	0.7383966244725738

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03797	Autotransporter	1.29e-22	355	590	3	254	Autotransporter beta-domain. Secretion of protein products occurs by a number of different pathways in bacteria. One of these pathways known as the type V pathway was first described for the IgA1 protease. The protein component that mediates secretion through the outer membrane is contained within the secreted protein itself, hence the proteins secreted in this way are called autotransporters. This family corresponds to the presumed integral membrane beta-barrel domain that transports the protein. This domain is found at the C-terminus of the proteins it occurs in. The N-terminus contains the variable passenger domain that is translocated across the membrane. Once the passenger domain is exported it is cleaved auto-catalytically in some proteins, in others a different protease is used and in some cases no cleavage occurs.
pfam12138	Spherulin4	9.67e-19	126	297	60	238	Spherulation-specific family 4. This protein is found in bacteria, archaea and eukaryotes. Proteins in this family are typically between 250 and 398 amino acids in length. There is a conserved NPG sequence motif and there are two completely conserved G residues that may be functionally important. Starvation will often induce spherulation - the production of spores - and this process may involve DNA-methylation. Changes in the methylation of spherulin4 are associated with the formation of spherules, but these changes are probably transient. Methylation of the gene accompanies its transcriptional activation, and spherulin4 mRNA is only detectable in late spherulating cultures and mature spherules. It is a spherulation-specific protein.
smart00869	Autotransporter	3.58e-18	355	597	1	265	Autotransporter beta-domain. Secretion of protein products occurs by a number of different pathways in bacteria. One of these pathways known as the type IV pathway was first described for the IgA1 protease. The protein component that mediates secretion through the outer membrane is contained within the secreted protein itself, hence the proteins secreted in this way are called autotransporters. This family corresponds to the presumed integral membrane beta-barrel domain that transports the protein. This domain is found at the C-terminus of the proteins it occurs in. The N-terminus contains the variable passenger domain that is translocated across the membrane. Once the passenger domain is exported it is cleaved auto-catalytically in some proteins, in others a different peptidase is used and in some cases no cleavage occurs.
TIGR01414	autotrans_barl	2.83e-08	344	519	156	326	outer membrane autotransporter barrel domain. A number of Gram-negative bacterial proteins, mostly found in pathogens and associated with virulence, contain a conserved C-terminal domain that integrates into the outer membrane and enables the N-terminal region to be delivered across the membrane. This C-terminal autotransporter domain is about 400 amino acids in length and includes the aromatic amino acid-rich OMP signal, typically ending with a Phe or Trp residue, at the extreme C-terminus. [Protein fate, Protein and peptide secretion and trafficking, Cellular processes, Pathogenesis]
COG4625	COG4625	3.11e-07	356	591	308	558	Uncharacterized conserved protein, contains a C-terminal beta-barrel porin domain [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASQ47822.1	5.54e-184	31	607	143	707
QUB96211.1	8.08e-183	31	607	140	704
BBM45129.1	2.55e-140	49	607	216	765
BBM57219.1	2.55e-140	49	607	216	765
BBM39370.1	2.91e-56	27	299	38	281

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999976	0.000052	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003713_00110.