CAZyme Information: MGYG000003715_00342

Basic Information

• Species: Muricomes sp900604355
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Muricomes; Muricomes sp900604355
• CAZyme ID: MGYG000003715_00342
• CAZy Family: GT4
• CAZyme Description: D-inositol-3-phosphate glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
359	MGYG000003715_3|CGC2	41153.23	5.6461

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003715	3533714	MAG	Finland	Europe

• Gene Location: Start: 48818; End: 49897 Strand: +

Full Sequence      

MRIIQILPVLAYGDAIGNDTVALRDALLEAGYKTEIYAEVIDGRLPQGTARQVEELTVDK
DDVLLYHLSTCSDLNYKLEQYDCKRMILYHNITPPAFFKGINREVEKNCEDGLAGARHLA
RKVEYALADSEYNKKDLINMGYSCKIDVLPILIAFDDYGGKPDKKVLNKYNDGYTNVIFT
GRVAPNKKQEDVIRAFHFYHKYLNPESRLFIVGSYTGMEQYYGMLKDYVKRLDIEDSVYF
TGHIKFKEILAYYHLADLFLCMSEHEGFCVPLVEAMYFKVPVIAYHSSAVGETLGGSGFL
LEKKDPVETAMAMKRIMEDEGLRNTIIANEQARLQDFSHVKIKEKFYKLIEENINEVQS

Enzyme Prediction     

No EC number prediction in MGYG000003715_00342.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	176	325	2.3e-32	0.9125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03809	GT4_MtfB-like	2.29e-32	50	338	74	352	glycosyltransferases MtfB, WbpX, and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. MtfB (mannosyltransferase B) in E. coli has been shown to direct the growth of the O9-specific polysaccharide chain. It transfers two mannoses into the position 3 of the previously synthesized polysaccharide.
COG0438	RfaB	4.44e-30	119	356	147	380	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03801	GT4_PimA-like	3.95e-29	20	351	38	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
cd03817	GT4_UGDG-like	1.73e-25	117	348	142	370	UDP-Glc:1,2-diacylglycerol 3-a-glucosyltransferase and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. UDP-glucose-diacylglycerol glucosyltransferase (EC 2.4.1.337, UGDG; also known as 1,2-diacylglycerol 3-glucosyltransferase) catalyzes the transfer of glucose from UDP-glucose to 1,2-diacylglycerol forming 3-D-glucosyl-1,2-diacylglycerol.
pfam00534	Glycos_transf_1	2.22e-25	177	329	5	154	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRP37264.1	3.69e-134	1	356	1	356
ASN97925.1	3.69e-134	1	356	1	356
QIX91413.1	1.72e-132	1	356	1	356
QTE72662.1	6.53e-125	1	350	1	352
QTE73647.1	1.86e-124	1	350	1	352

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5I45_A	1.27e-09	163	329	23	187	1.35Angstrom Crystal Structure of C-terminal Domain of Glycosyl Transferase Group 1 Family Protein (LpcC) from Francisella tularensis. [Francisella tularensis subsp. tularensis SCHU S4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q4JAK2	2.58e-08	117	330	128	334	Archaeal glycosylation protein 16 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) OX=330779 GN=agl16 PE=3 SV=1
P39862	1.57e-06	126	336	143	355	Capsular polysaccharide biosynthesis glycosyltransferase CapM OS=Staphylococcus aureus OX=1280 GN=capM PE=3 SV=1
O05083	1.95e-06	205	346	211	349	Uncharacterized glycosyltransferase HI_1698 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1698 PE=3 SV=1
Q9H553	3.00e-06	220	350	279	411	Alpha-1,3/1,6-mannosyltransferase ALG2 OS=Homo sapiens OX=9606 GN=ALG2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000019	0.000014	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003715_00342.