CAZyme Information: MGYG000003716_00926

Basic Information

• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Mycobacteriaceae; Lawsonella
• CAZyme ID: MGYG000003716_00926
• CAZy Family: GT87
• CAZyme Description: Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol mannoside mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
311		34431.02	9.7827

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003716	1367201	MAG	Canada	North America

• Gene Location: Start: 2048; End: 2983 Strand: -

Full Sequence      

MLLLAVVIGMVLRERGYRVDRYTCYLAVSLAVGAVFLDPIRTTLVFGQINIILMLLVAIG
FLRKGDHWGAGIGIGLAAGIKLTPGFFVIVLAIQRRWRTLATSVLAFAATIACGFWVLPA
DSHTYWLHSMLHNNRVGSYLNRADQSLQAVVYRMAGGPTPWWIAVELVGVILILATLWYA
AYLRNNTLMMALGGLGACLLSPFSWNHHYVWIVPILLVMVDALVNHWVAHSGWVRAWIVC
GIAGVVGTTATWMAEIVPHKKGPLVGAPLVTMYSYPYLFWQGIYVFMTLAVFVGVLVYSR
ARYTSQQTISC

Enzyme Prediction     

No EC number prediction in MGYG000003716_00926.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT87	2	202	3.3e-52	0.8614718614718615

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13375	pimE	2.72e-27	34	300	140	395	mannosyltransferase; Provisional
pfam09594	GT87	2.91e-24	2	202	32	237	Glycosyltransferase family 87. The enzymes in this family are glycosyltransferases. PimE is involved in phosphatidylinositol mannoside (PIM) synthesis, a major class of glycolipids in all mycobacteria. PimE is a polyprenol-phosphate-mannose-dependent mannosyltransferase that transfers the fifth mannose of PIM. The family also includes alpha(1-->3) arabinofuranosyltransferase, invloved in the synthesis of of mycobacterial arabinogalactan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VHO00063.1	6.14e-86	169	310	2	143
ALE18687.1	1.89e-82	169	310	2	143
AHW63849.1	9.20e-53	3	256	96	350
AQS74468.1	4.92e-52	2	254	100	347
APT83467.1	4.92e-52	2	254	100	347

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WMZ8	1.19e-25	25	261	143	377	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol mannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT2236 PE=3 SV=1
P9WMZ9	1.19e-25	25	261	143	377	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol mannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2181 PE=1 SV=1
A0R036	4.79e-25	27	255	148	383	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol mannoside mannosyltransferase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=MSMEG_4247 PE=1 SV=1
P9WN00	1.55e-21	34	290	165	410	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol pentamannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pimE PE=3 SV=1
P9WN01	1.55e-21	34	290	165	410	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol pentamannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pimE PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000021	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
20	37
44	61
71	93
100	119
161	183
188	205
209	228
235	257
277	299