CAZyme Information: MGYG000003716_00947

Basic Information

• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Mycobacteriaceae; Lawsonella
• CAZyme ID: MGYG000003716_00947
• CAZy Family: GH23
• CAZyme Description: Resuscitation-promoting factor RpfB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
381		41631.05	10.6877

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003716	1367201	MAG	Canada	North America

• Gene Location: Start: 255; End: 1400 Strand: +

Full Sequence      

MAEEAQQKTDTPRRIHPAWRILLAVALVAVTVTAGISMVYHRTVTLVVDGEKKQVGTYSQ
TVGEVLDSLGYQVSADDHVEPSPDTQLSANATITYQQKRPFTVEIHSGFGKRAKVERVSI
TTTAYTVAEALKEVKAVRPSYGINVAPDKRIPTNGLSIEAITPRTVWLTDFGKKPVRIRV
GAFTVRDALAKLGTPLRSTDDVTPGPDADLLPNMKIKVVRYGDMVKDRVIRLKPFEKILK
DPSQLAGIRTIVKRGKPGRAVLTERLVFDKKGRIVKRILIKRVVAVKPGKSTVKVGSQPI
DAVWDRLAQCEAGGNWAVNTGNGFFGGLQFTQGTWEAHGGRAYASRADLATREEQIAVAK
RVQASQGWGAWPACTSSMGLR

Enzyme Prediction     

No EC number prediction in MGYG000003716_00947.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3583	YabE	1.84e-45	15	321	7	309	Uncharacterized conserved protein YabE, contains G5 and tandem DUF348 domains [Function unknown].
pfam06737	Transglycosylas	2.95e-44	301	374	2	75	Transglycosylase-like domain. This family of proteins are very likely to act as transglycosylase enzymes related to pfam00062 and pfam01464. These other families are weakly matched by this family, and include the known active site residues.
cd13925	RPF	4.25e-34	302	374	1	71	core lysozyme-like domain of resuscitation-promoting factor proteins. Resuscitation-promoting factor (RPF) proteins, found in various (G+C)-rich Gram-positive bacteria, act to reactivate cultures from stationary phase. This protein shares elements of the structural core of lysozyme and related proteins. Furthermore, it shares a conserved active site glutamate which is required for activity, and has a polysaccharide binding cleft that corresponds to the peptidoglycan binding cleft of lysozyme. Muralytic activity of Rpf in Micrococcus luteus correlates with resuscitation, supporting a mechanism dependent on cleavage of peptidoglycan by RPF.
pfam03990	DUF348	2.55e-12	44	84	1	41	Domain of unknown function (DUF348). This domain normally occurs as tandem repeats; however it is found as a single copy in the S. cerevisiae DNA-binding nuclear protein YCR593. This protein is involved in sporulation part of the SET3C complex, which is required to repress early/middle sporulation genes during meiosis. The bacterial proteins are likely to be involved in a cell wall function as they are found in conjunction with the pfam07501 domain, which is involved in various cell surface processes.
cd00442	Lyz-like	9.10e-08	303	361	1	58	lysozyme-like domains. This family contains several members, including soluble lytic transglycosylases (SLT), goose egg-white lysozymes (GEWL), hen egg-white lysozymes (HEWL), chitinases, bacteriophage lambda lysozymes, endolysins, autolysins, chitosanases, and pesticin. Typical members are involved in the hydrolysis of beta-1,4- linked polysaccharides.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VHO00033.1	8.24e-252	1	381	1	381
ALE34358.1	5.55e-242	15	381	1	367
ALE19588.1	7.89e-242	15	381	1	367
AHD23011.1	1.81e-77	25	381	19	375
AOD22115.1	1.81e-77	25	381	19	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5E27_A	2.78e-47	150	381	11	248	ChainA, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis],5E27_B Chain B, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis]
3EO5_A	1.29e-36	232	381	15	171	ChainA, Resuscitation-promoting factor rpfB [Mycobacterium tuberculosis]
1XSF_A	8.10e-36	283	381	2	108	ChainA, Probable resuscitation-promoting factor rpfB [Mycobacterium tuberculosis]
4KL7_A	7.39e-35	302	381	1	80	ChainA, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis],4KL7_B Chain B, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis],4KL7_C Chain C, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis],4KL7_D Chain D, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis],4KPM_A Chain A, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis],4KPM_B Chain B, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis],4KPM_C Chain C, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis],4KPM_D Chain D, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis]
4EMN_A	7.60e-35	302	381	2	81	ChainA, Probable resuscitation-promoting factor rpfB [Mycobacterium tuberculosis],4EMN_B Chain B, Probable resuscitation-promoting factor rpfB [Mycobacterium tuberculosis],4EMN_C Chain C, Probable resuscitation-promoting factor rpfB [Mycobacterium tuberculosis],4EMN_D Chain D, Probable resuscitation-promoting factor rpfB [Mycobacterium tuberculosis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0R3E0	3.89e-60	27	381	10	362	Resuscitation-promoting factor RpfB OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=rpfB PE=3 SV=2
H8EZH5	3.01e-59	20	381	3	362	Resuscitation-promoting factor RpfB OS=Mycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman) OX=652616 GN=rpfB PE=2 SV=1
P9WG28	3.01e-59	20	381	3	362	Resuscitation-promoting factor RpfB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=rpfB PE=3 SV=1
P9WG29	3.01e-59	20	381	3	362	Resuscitation-promoting factor RpfB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=rpfB PE=1 SV=1
Q6M6N7	2.05e-55	48	381	49	374	Resuscitation-promoting factor Rpf2 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=rpf2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999790	0.000135	0.000003	0.000001	0.000000	0.000098

TMHMM  Annotations     

start	end
21	40