CAZyme Information: MGYG000003721_00243

Basic Information

• Species: Peptoniphilus_C urinimassiliensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Tissierellales; Peptoniphilaceae; Peptoniphilus_C; Peptoniphilus_C urinimassiliensis
• CAZyme ID: MGYG000003721_00243
• CAZy Family: GH171
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
544	MGYG000003721_13|CGC1	60194.14	10.0907

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003721	1482893	MAG	Canada	North America

• Gene Location: Start: 5169; End: 6803 Strand: +

Full Sequence      

MKKFFKLSVFILILCGLMTPSRAHAQKVRAARSPQALVVDGQMTDLRGYNIGGYNYYRLR
DLAQILKGKVDFDLKGDNKQIVVDRTKTYQSFPGDQSGAAKERAVLQPMRLKVLGENPAD
VVENAYNIRGFNYFRLRSVGAVLGFDVSYDEGKNLAVITTSADRKPAPAPAPQSPTGRVI
LGNERLLTEYKGLIDNKRVGLITNQTGVDANGVPVAEKIKAYPNAKLVALYSPEHGLDGK
QTAGAYVASYFDKKMNLPVYSLYGPTRKPSRDMLKGVDVLVYDMQDIGSRTYTYISTLQN
AMVAAKENNIPIVVLDRPNPLGGEIVEGFLRETRFKSFVGIDKIPMAHGMTAGELGQFFN
REIGADLTVVPMKNWTRSMVWQDTGLPFAQTSPNIPNLESAFLYMATGSGEGTGIGQSEY
FRWVGGKNLDSAEYARRLNAANLPGVTFIAAPKGSRGGVRLKVTDWHRFNPARTGVYTLA
VANQMRPITVPACKRPYHMFYLVQGSEQMANLFRSGASPETIVKAYERDVNAFKAQRTQY
LIYK

Enzyme Prediction     

No EC number prediction in MGYG000003721_00243.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH171	199	543	3.7e-109	0.9971830985915493

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07075	DUF1343	4.44e-157	200	543	1	362	Protein of unknown function (DUF1343). This family consists of several hypothetical bacterial proteins of around 400 residues in length. The function of this family is unknown.
COG3876	YbbC	8.07e-115	178	543	25	409	Uncharacterized conserved protein YbbC, DUF1343 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEJ36366.1	1.30e-288	1	544	1	541
EFE27594.2	3.41e-157	165	544	45	421
CBH20341.1	1.62e-154	146	543	18	417
QGU96809.1	2.82e-144	181	543	12	374
BAU27066.1	4.48e-142	171	544	27	401

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K05_A	1.80e-68	170	544	4	399	Crystalstructure of a DUF1343 family protein (BF0371) from Bacteroides fragilis NCTC 9343 at 1.65 A resolution [Bacteroides fragilis NCTC 9343],4K05_B Crystal structure of a DUF1343 family protein (BF0371) from Bacteroides fragilis NCTC 9343 at 1.65 A resolution [Bacteroides fragilis NCTC 9343]
4JJA_A	1.25e-42	179	544	6	369	Crystalstructure of a DUF1343 family protein (BF0379) from Bacteroides fragilis NCTC 9343 at 1.30 A resolution [Bacteroides fragilis NCTC 9343]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40407	1.31e-93	178	543	36	414	Uncharacterized protein YbbC OS=Bacillus subtilis (strain 168) OX=224308 GN=ybbC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000342	0.998409	0.000694	0.000201	0.000172	0.000152

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003721_00243.