CAZyme Information: MGYG000003723_00384

Basic Information

• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Actinomycetaceae; Mobiluncus
• CAZyme ID: MGYG000003723_00384
• CAZy Family: GH33
• CAZyme Description: Sialidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
378		41189.49	5.3802

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003723	2071852	MAG	Canada	North America

• Gene Location: Start: 67161; End: 68297 Strand: +

Full Sequence      

MQRTVVAPHVTSGFTQARYPAIARTSSRVLLMMWEALPSECATRTSAELAGANPASPEEP
HYRRLCPTSLCLSRSFDNGLTWEEPRTLAAGNPQEFLGFHVPSFLHDRVTGRMFCFYTRS
LVPGWDSRQAQTALFVAWTDDDGLTWEHQDITSMIIAGRDFTMAYIPRGRGTQLTAGQWA
QRLCHAGVIVDESGDRKAVFIGSDDHGASWWASPPVGANVDYCSAVSNSDGTEVMLLIKT
QGSTVKTWAKSTDGGRTFGQPTAAMDSRLINIMSPLEEVFHGACPGTPHADVFSYIGERT
VCNGDCTVLMLSVDGARSFREAAIFDVKTYGAIDIVSLADQAKFAIAYEGPDGVVCEILP
FSKLSSIKALAEQWAQQA

Enzyme Prediction     

No EC number prediction in MGYG000003723_00384.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	11	352	3.7e-33	0.9181286549707602

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	2.57e-36	4	365	1	339	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	3.51e-07	72	263	22	203	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
pfam13088	BNR_2	4.66e-04	74	261	86	254	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADI66437.1	2.09e-248	1	378	1	378
QQU08038.1	2.09e-248	1	378	1	378
QQT13522.1	3.30e-245	1	378	1	378
QGH70343.1	1.58e-30	11	349	64	395
AVM62488.1	1.71e-29	4	369	276	635

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4J9T_A	3.00e-29	67	354	50	345	Crystalstructure of a putative, de novo designed unnatural amino acid dependent metalloprotein, northeast structural genomics consortium target OR61 [Micromonospora viridifaciens]
1EUR_A	5.58e-28	13	354	21	349	Sialidase[Micromonospora viridifaciens],1EUS_A Sialidase Complexed With 2-Deoxy-2,3-Dehydro-N- Acetylneuraminic Acid [Micromonospora viridifaciens]
2BER_A	2.33e-27	13	354	17	345	Y370GActive Site Mutant of the Sialidase from Micromonospora viridifaciens in complex with beta-Neu5Ac (sialic acid). [Micromonospora viridifaciens]
1WCQ_A	4.27e-27	13	354	17	345	Mutagenesisof the Nucleophilic Tyrosine in a Bacterial Sialidase to Phenylalanine. [Micromonospora viridifaciens],1WCQ_B Mutagenesis of the Nucleophilic Tyrosine in a Bacterial Sialidase to Phenylalanine. [Micromonospora viridifaciens],1WCQ_C Mutagenesis of the Nucleophilic Tyrosine in a Bacterial Sialidase to Phenylalanine. [Micromonospora viridifaciens]
2BZD_A	4.27e-27	13	354	17	345	Galactoserecognition by the carbohydrate-binding module of a bacterial sialidase. [Micromonospora viridifaciens],2BZD_B Galactose recognition by the carbohydrate-binding module of a bacterial sialidase. [Micromonospora viridifaciens],2BZD_C Galactose recognition by the carbohydrate-binding module of a bacterial sialidase. [Micromonospora viridifaciens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q02834	2.65e-26	13	354	63	391	Sialidase OS=Micromonospora viridifaciens OX=1881 GN=nedA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999516	0.000501	0.000008	0.000001	0.000001	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003723_00384.