CAZyme Information: MGYG000003727_01137

Basic Information

• Species: Peptoniphilus_A lacrimalis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Tissierellales; Peptoniphilaceae; Peptoniphilus_A; Peptoniphilus_A lacrimalis
• CAZyme ID: MGYG000003727_01137
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1215		135972.35	6.3304

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003727	1599854	MAG	Canada	North America

• Gene Location: Start: 26142; End: 29789 Strand: +

Full Sequence      

MLIVTDRNLQTLTIVSNDYPDGVHFQDDKFNENLETGTCMLTCSIDKVVEKDVELIEAGC
LVVATGYKKKPVLLEITEVVETRYSKEIVAEDCGLDLLNEDIAEQDFKGTLVEWVNNTLG
DKSDWVVGINEAKDKNLAFKFDGTTTKTKRLAMIAGRFGCEISYDVKLNGNAIDKKVINF
YKKRGKETGYRLEFGRDLSDVKRTVSIADLCTAVRAVGKPHKEQIREVKQVEIEEDKKKP
APNSKIELFVKWMKSREGKVRYSQARREGPNYYDCSSSVSSAAKFAGLFPKSVGLPTTGT
LWAWGNAGTYFHQINQSEIQYGDIFVSRHNNKGHTGVILDKNTIIHCTLYGSINGIVTTK
LSGWTGPNVRFYRWNENKGGTIVDATKKTYWTNSDVTKHDLGKRLQGITATQINNWIKAK
APNSPFNGQGQVFIEAQSQSGLDARYILAHAALESAWGSSRIARTYHNYFGINAYDSNPD
NAKKSSNRSLQAGIINGAVWIKEHYYNRGQKTLYAMNHDKNGHNYASDKAWGDKIANIMK
GSERFTNPGATASSTEQVSYKEHEVNTDLVGYKYDDGRFYVTDDGLICDREAAKKWTRFN
KTGQKYFIRMYDSEATSQKTLFDEGLRFLKNNNEAKISYEVSLRQLPGELEIGDYIRIID
HGFKPALYLSARLVDITRSLCDELSNSAIFANFEEEKAGISERLLSLEKSVYSSRFNWQN
VPYEMQLSSSQGNVFKDGVLSTEITAIVTKAGVDQTAMIDKFVWERVSEYQDKISTSDED
WNKSKEGSTGNILGINNTDVDLQATFTCSAMLNDVAVATSFITIKDLTIGIYKQEKEPDR
QLLSWGDVWQWDDGKGTHFKRLWKGDRWEDTITKRDLEILEFAPGPPGKDGENGMPGKDG
KDGRTSYVHFAYADSADGTVGFTRTATSNKKYIGFYTDFEKADSTDPKKYEWSKYVGDDG
KPGKDGENGIPGKAGADGKTPYFHTAWSNSADGSKDFSTSQAGEKAYIGTYTDYVKEDST
DPTKYTWMFVKGEKGDPADTSGIKKDINAIKSELENKADSQTVTDIESRQQAVEVLISQK
ADKDSITKSFVEIEKTKAYADTLKKALENESLSLQDRIKIIEENVGAGKFTIEAITTYFD
FGEEGILIGKKDEAVKMILKNNALEIVDGTKTVARFANSQVQVPNLKVDGVLEFGYHVVT
KHDNGVNKYTIIKPI

Enzyme Prediction     

No EC number prediction in MGYG000003727_01137.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	430	540	1.7e-22	0.953125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4193	LytD	2.40e-29	406	542	79	228	Beta- N-acetylglucosaminidase [Carbohydrate transport and metabolism].
smart00047	LYZ2	7.17e-23	418	541	1	138	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
pfam05382	Amidase_5	2.33e-20	246	375	2	136	Bacteriophage peptidoglycan hydrolase. At least one of the members of this family, the Pal protein from the pneumococcal bacteriophage Dp-1 has been shown to be a N-acetylmuramoyl-L-alanine amidase. According to the known modular structure of this and other peptidoglycan hydrolases from the pneumococcal system, the active site should reside at the N-terminal domain whereas the C-terminal domain binds to the choline residues of the cell wall teichoic acids. This family appears to be related to pfam00877.
pfam01832	Glucosaminidase	2.19e-14	430	475	1	46	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
TIGR01665	put_anti_recept	3.81e-09	27	219	1	193	phage minor structural protein, N-terminal region. This model represents the conserved N-terminal region, typically from about residue 25 to about residue 350, of a family of uncharacterized phage proteins 500 to 1700 residues in length. [Mobile and extrachromosomal element functions, Prophage functions]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKH79738.1	0.0	1	1215	1	1476
QTJ33236.1	0.0	1	1214	1	1391
ALB16165.1	1.94e-48	1	1032	1	1045
ASA81954.1	1.94e-48	1	1032	1	1045
ASA84007.1	1.94e-48	1	1032	1	1045

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4Q2W_A	2.31e-19	423	538	165	278	CrystalStructure of pneumococcal peptidoglycan hydrolase LytB [Streptococcus pneumoniae TIGR4]
4PI7_A	7.38e-17	355	561	22	228	ChainA, Autolysin E [Staphylococcus aureus subsp. aureus Mu50],4PI9_A Chain A, Autolysin E [Staphylococcus aureus subsp. aureus Mu50],4PIA_A Chain A, Autolysin E [Staphylococcus aureus subsp. aureus Mu50]
4PI8_A	4.57e-16	355	561	22	228	ChainA, Autolysin E [Staphylococcus aureus subsp. aureus Mu50]
6FXO_A	1.28e-14	406	541	71	226	ChainA, Bifunctional autolysin [Staphylococcus aureus subsp. aureus Mu50]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P59205	5.69e-18	423	539	533	647	Putative endo-beta-N-acetylglucosaminidase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=lytB PE=1 SV=1
P59206	6.24e-18	423	539	577	691	Putative endo-beta-N-acetylglucosaminidase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=lytB PE=1 SV=1
Q5HH31	1.15e-12	364	541	1049	1238	Bifunctional autolysin OS=Staphylococcus aureus (strain COL) OX=93062 GN=atl PE=3 SV=1
Q99V41	1.50e-12	406	541	1075	1230	Bifunctional autolysin OS=Staphylococcus aureus (strain N315) OX=158879 GN=atl PE=1 SV=1
Q931U5	1.50e-12	406	541	1075	1230	Bifunctional autolysin OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) OX=158878 GN=atl PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003727_01137.