CAZyme Information: MGYG000003729_00996

Basic Information

• Species: Peptostreptococcus sp000758885
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Peptostreptococcaceae; Peptostreptococcus; Peptostreptococcus sp000758885
• CAZyme ID: MGYG000003729_00996
• CAZy Family: GH23
• CAZyme Description: Soluble lytic murein transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
185	MGYG000003729_60|CGC1	21528.02	10.1432

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003729	1511126	MAG	Canada	North America

• Gene Location: Start: 3462; End: 4019 Strand: +

Full Sequence      

MKVRKLKASRLILALILVFIALFMALNYKKIGYALYPTKFSEYVEKYSSEYGVDKYLVYS
IIKTESKFHTRAISSKKAKGLMQITDKTAAWGRQELGLGDADIYDPETNIRIGIWYLGKL
QKEFRGEYKLVIAAYNGGSGNVRKWLRTRDYSKDGKNLAKIPFNETSKYSQKVLDNYEKY
KYLYE

Enzyme Prediction     

No EC number prediction in MGYG000003729_00996.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	56	180	6.3e-32	0.7925925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	2.55e-67	37	179	1	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	7.57e-52	35	183	1	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	8.10e-37	57	178	3	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	1.57e-35	23	184	122	287	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
cd16893	LT_MltC_MltE	3.75e-32	42	178	1	162	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPK99408.1	1.46e-64	18	184	11	178
AVD40846.1	1.46e-64	18	184	11	178
QQY50391.1	1.46e-64	18	184	11	178
QQY75444.1	1.46e-64	18	184	11	178
AXU49364.1	1.46e-64	18	184	11	178

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	4.38e-19	29	184	404	559	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	4.39e-19	29	184	408	563	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	4.40e-19	29	184	414	569	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	4.41e-19	29	184	418	573	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	4.43e-19	29	184	424	579	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	7.47e-16	44	177	64	179	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
P44888	2.82e-13	37	174	425	566	Putative soluble lytic murein transglycosylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=slt PE=3 SV=1
A8GJ50	5.26e-13	39	142	190	305	Membrane-bound lytic murein transglycosylase C OS=Serratia proteamaculans (strain 568) OX=399741 GN=mltC PE=3 SV=1
Q2NRB3	9.77e-13	39	184	190	346	Membrane-bound lytic murein transglycosylase C OS=Sodalis glossinidius (strain morsitans) OX=343509 GN=mltC PE=3 SV=1
C5BCE9	1.83e-12	39	142	190	305	Membrane-bound lytic murein transglycosylase C OS=Edwardsiella ictaluri (strain 93-146) OX=634503 GN=mltC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.991294	0.006656	0.001427	0.000027	0.000018	0.000608

TMHMM  Annotations     

start	end
11	28