CAZyme Information: MGYG000003733_03865

Basic Information

• Species: Bradyrhizobium sp003020075
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Xanthobacteraceae; Bradyrhizobium; Bradyrhizobium sp003020075
• CAZyme ID: MGYG000003733_03865
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
484		51505.65	5.5806

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003733	7397431	MAG	Canada	North America

• Gene Location: Start: 2856; End: 4310 Strand: +

Full Sequence      

MTPIRVLAVASEVYPIVKTGGLADVVGALPAALKEHGVATRTLVPGYPAVLKALASAETL
LHREEFYGGPIRVLAGSHDGLDLFALDAPHLYARPGNPYVDPDGRDWPDNGIRFAALSRM
AAEIGRGAIAAFVPDIVHAHDWQAGLAPAYLHYGGQPRPGTVMTVHNLAYQGQFSPDMLP
TFGLPGEAYSLHGVEYYGTISLLKAGLQFADRITTVSPTYAQEIQSDEGGMGLGGLLRER
ADVLSGILNGIDIEVWNPATDPDIAARFSAEQIAERAANKAALQRRFGLDPVPDAMLLGV
ISRLSWQKGLDLLLDNIPTLLSEGIQLALLGSGDRDLQDRYTALARDNPGRIAVVIGYDE
ALAHLIQAGSDALAVPSRFEPCGLTQLCALRYGAVPVVADVGGLADTVLGFDEAAVTGGA
ATGVKFAPVTSEALAHGLRTANLLFNDKVTWRRLQQAGMATDVSWHNRASRYAALYREIA
AARR

Enzyme Prediction     

EC	2.4.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	5	477	1.3e-161	0.9957627118644068

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0297	GlgA	0.0	5	483	2	482	Glycogen synthase [Carbohydrate transport and metabolism].
PRK00654	glgA	0.0	5	482	2	466	glycogen synthase GlgA.
cd03791	GT5_Glycogen_synthase_DULL1-like	0.0	5	478	1	474	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
PRK14099	PRK14099	0.0	1	484	1	484	glycogen synthase GlgA.
TIGR02095	glgA	0.0	4	479	1	473	glycogen/starch synthase, ADP-glucose type. This family consists of glycogen (or starch) synthases that use ADP-glucose (EC 2.4.1.21), rather than UDP-glucose (EC 2.4.1.11) as in animals, as the glucose donor. This enzyme is found in bacteria and plants. Whether the name given is glycogen synthase or starch synthase depends on context, and therefore on substrate. [Energy metabolism, Biosynthesis and degradation of polysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOZ36075.1	0.0	1	483	1	483
AUC95400.1	0.0	1	484	1	484
QIG97991.1	0.0	1	484	1	484
BBC02099.1	0.0	1	484	1	484
QOZ15816.1	0.0	1	484	1	484

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1RZU_A	4.45e-162	5	479	2	475	ChainA, Glycogen synthase 1 [Agrobacterium tumefaciens],1RZU_B Chain B, Glycogen synthase 1 [Agrobacterium tumefaciens]
1RZV_A	2.18e-157	5	479	2	475	ChainA, Glycogen synthase 1 [Agrobacterium tumefaciens],1RZV_B Chain B, Glycogen synthase 1 [Agrobacterium tumefaciens]
3D1J_A	9.09e-139	5	476	2	473	ChainA, Glycogen synthase [Escherichia coli]
2QZS_A	1.67e-138	5	476	2	473	CrystalStructure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSb) [Escherichia coli],2R4T_A Crystal Structure of Wild-type E.coli GS in Complex with ADP and Glucose(wtGSc) [Escherichia coli],2R4U_A Crystal Structure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSd) [Escherichia coli],3GUH_A Crystal Structure of Wild-type E.coli GS in complex with ADP and DGM [Escherichia coli K-12]
3COP_A	1.34e-137	5	476	2	473	ChainA, Glycogen synthase [Escherichia coli],3CX4_A Chain A, Glycogen synthase [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q89G86	5.42e-254	1	484	1	481	Glycogen synthase 2 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110) OX=224911 GN=glgA2 PE=3 SV=1
Q07TH8	6.50e-219	1	483	1	483	Glycogen synthase OS=Rhodopseudomonas palustris (strain BisA53) OX=316055 GN=glgA PE=3 SV=1
Q21BQ1	1.86e-218	1	483	1	483	Glycogen synthase OS=Rhodopseudomonas palustris (strain BisB18) OX=316056 GN=glgA PE=3 SV=1
Q6NCT7	8.13e-216	1	483	1	483	Glycogen synthase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) OX=258594 GN=glgA PE=3 SV=1
B3Q9C2	2.69e-214	1	483	1	483	Glycogen synthase OS=Rhodopseudomonas palustris (strain TIE-1) OX=395960 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003733_03865.