CAZyme Information: MGYG000003733_03933

Basic Information

• Species: Bradyrhizobium sp003020075
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Xanthobacteraceae; Bradyrhizobium; Bradyrhizobium sp003020075
• CAZyme ID: MGYG000003733_03933
• CAZy Family: GT39
• CAZyme Description: putative dolichyl-phosphate-mannose--protein mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
434	MGYG000003733_104|CGC1	47746.77	9.7875

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003733	7397431	MAG	Canada	North America

• Gene Location: Start: 10252; End: 11556 Strand: -

Full Sequence      

MSIATKSSSADRRPAARAAIVAAIIFVVAHVLLLLGITTPDKLYFDEVHYVPAARQMLQP
VVEGPILNPMHPPLAKEIVALSIKAFGDGPLGWRYPAALFGALALVGVYLAALALFASQE
RAIAAVLIAFFNQMLFVQSRIAMLDIFALAFCLFAIAAFIRGFRQTRPHSAFALAGLAVG
LASACKWSGLFVLATCIAIVVVIRLMQGWRTRFADANAQDWYQPDLWPDFRLPHVIVCFV
LIPSAVYLATFVPLVGLSFSGLVEAQRRIFADNTTTAIAGHTYMSSWPTWPLLVRPVWYL
FEKAGDDRFAAVVFLGNPLVLWPALIALIVALRDWIVDRSRDAFLVLAFYLGPYLAWALL
PRTLGFIYYYLPAATTASFVLVYALTRKGAPRWLLWAFVAVGCAGFIAMLPITVAAIGTS
IATFNRLMLFQNWI

Enzyme Prediction     

No EC number prediction in MGYG000003733_03933.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	25	253	3.6e-50	0.9820627802690582

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4346	COG4346	1.64e-15	67	389	132	416	Predicted membrane-bound dolichyl-phosphate-mannose-protein mannosyltransferase [Posttranslational modification, protein turnover, chaperones].
COG1928	PMT1	4.05e-15	31	251	36	264	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
pfam16192	PMT_4TMC	3.22e-11	262	430	3	197	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
COG1807	ArnT	1.03e-10	31	431	19	386	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
pfam02366	PMT	3.74e-10	34	251	12	237	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIG94674.1	1.21e-273	1	434	1	434
BBB97506.1	5.72e-272	1	434	1	434
QOZ19780.1	5.72e-272	1	434	1	434
AUC95228.1	3.01e-267	1	434	1	434
QOZ31964.1	2.47e-266	1	434	1	434

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
L8F4Z2	8.95e-18	45	368	67	441	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycolicibacterium smegmatis (strain MKD8) OX=1214915 GN=pmt PE=3 SV=1
Q8NRZ6	9.27e-16	45	368	64	445	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=pmt PE=3 SV=1
P9WN04	1.63e-13	45	382	73	457	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pmt PE=3 SV=2
P9WN05	1.63e-13	45	382	73	457	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pmt PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000023	0.000006	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
20	39
95	117
122	137
141	163
184	206
235	257
277	299
309	331
343	360
364	386
393	415