CAZyme Information: MGYG000003733_04210

Basic Information

• Species: Bradyrhizobium sp003020075
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Xanthobacteraceae; Bradyrhizobium; Bradyrhizobium sp003020075
• CAZyme ID: MGYG000003733_04210
• CAZy Family: AA3
• CAZyme Description: Alcohol dehydrogenase [acceptor]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
539		58997.02	9.47

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003733	7397431	MAG	Canada	North America

• Gene Location: Start: 17618; End: 19237 Strand: +

Full Sequence      

MPRRLEGDFDYIIVGAGTAGCIVANRLSADPSKRVLLLEAGGKDNWIWFHIPVGYLFAIG
NPRSDWMFKTEAEPGLNGRALAYPRGKVIGGSSAINAMISMRGQAADYDHWRQLGLTGWS
YSDVLPAFKKLEDHFLGASEHHGVGGGWRIEAPRLSWQILDAVGDAAEEMGIKRIADFNT
GDNEGTSYFHVNQKRGRRWSSARGFLKPVLNRSNLRLETNVLVDRLIIESGRAAGVLFRQ
GNETVEARARGEVILCAGSIGTTQVLHRSGIGPSEWLSPLGIDIVADMQGIGHNLQDHLQ
QRAIYKVSGVRTLNETYYNLVRRGLMGLDYAFRRRGPLTMAPSQLGIFTRSDATRSRANI
QFHVQPLSLDKFGDPLHRFPAITVSACNLQPSSRGTVRIKSTAPDDKPSIAPNYLSTDDD
RQVAADAIRTTRRLMKQKALEQYHPEEFLPGPSVGDDDASLAKAAGDIGTTIFHPVGTAK
MGTANDPMAVVDERLRFYGLHGLRIADASVMPTITSGNTNTPTAMIAEKGAAMILRDAR

Enzyme Prediction     

No EC number prediction in MGYG000003733_04210.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	8	536	2.1e-155	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2303	BetA	0.0	2	539	1	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
PRK02106	PRK02106	0.0	9	535	6	532	choline dehydrogenase; Validated
TIGR03970	Rv0697	1.24e-77	10	535	2	487	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
pfam00732	GMC_oxred_N	1.35e-47	77	299	15	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
pfam05199	GMC_oxred_C	7.50e-42	391	529	1	142	GMC oxidoreductase. This domain found associated with pfam00732.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAD2222301.1	1.64e-173	1	535	1	547
CAB3230510.1	3.41e-118	6	534	22	555
QWC20507.1	2.83e-116	6	534	3	524
AWP09430.1	6.55e-107	3	534	13	550
ANI26486.1	1.89e-106	9	534	71	601

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YRU_AAA	7.34e-89	9	534	8	560	ChainAAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6ZH7_A	7.34e-89	9	534	8	560	ChainA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
7AV4_AAA	8.59e-89	9	534	84	636	ChainAAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YS1_AAA	1.03e-88	9	534	8	560	ChainAAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
5NCC_A	1.10e-88	9	534	24	576	Structureof Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9WWW2	5.70e-123	9	536	2	529	Alcohol dehydrogenase [acceptor] OS=Pseudomonas putida OX=303 GN=alkJ PE=3 SV=1
Q6UPE0	4.96e-118	6	534	43	576	Choline dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Chdh PE=1 SV=1
Q00593	8.41e-118	9	537	2	530	Alcohol dehydrogenase [acceptor] OS=Pseudomonas oleovorans OX=301 GN=alkJ PE=1 SV=1
Q8D3K2	9.94e-117	5	535	1	531	Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain CMCP6) OX=216895 GN=betA PE=3 SV=1
A7N2P9	3.63e-116	5	535	1	531	Oxygen-dependent choline dehydrogenase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) OX=1224742 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999940	0.000079	0.000006	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003733_04210.