CAZyme Information: MGYG000003733_04333

Basic Information

• Species: Bradyrhizobium sp003020075
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Xanthobacteraceae; Bradyrhizobium; Bradyrhizobium sp003020075
• CAZyme ID: MGYG000003733_04333
• CAZy Family: GT28
• CAZyme Description: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
366	MGYG000003733_124|CGC1	38162.4	10.517

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003733	7397431	MAG	Canada	North America

• Gene Location: Start: 1409; End: 2509 Strand: +

Full Sequence      

MDNPPLILLAAGGTGGHLFPAEALAVELIRRGLRVRLATDGRALRYSGLFGKESIELVPS
ATVRSRNPISLAQTVLMLGYGTLVAANVMRRLKPAAVVGFGGYPTLPPLVAARMLGVPGI
IHDANAVLGRANRFLSGRVNAIATSLPGVLDRDPALAGKATTVGTPMRPAILAAAAVKYT
PPEVNGPLRLLVVGGSQGARVMSDIVPPAIEQLDPALWSRLIVTQQVREEDMERVRAVYD
RLKINAELAPFFADLPARLASSQLVISRSGAGTVAELAAIGRPSILVPLPGAIDQDQFAN
AGVLSQAGGALRITQGDFTPERLAAEISAFAAEPSRLTAMADAARSVGRLDAAERLADLV
AKVAAL

Enzyme Prediction     

No EC number prediction in MGYG000003733_04333.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT28	190	351	2.1e-44	0.9808917197452229

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00726	murG	1.33e-138	4	365	1	356	undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional
cd03785	GT28_MurG	2.20e-117	7	359	2	350	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0707	MurG	1.27e-102	7	365	3	356	UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell wall/membrane/envelope biogenesis].
TIGR01133	murG	2.44e-88	7	360	3	348	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. RM 8449890 RT The final step of peptidoglycan subunit assembly in Escherichia coli occurs in the cytoplasm. RA Bupp K, van Heijenoort J. RL J Bacteriol 1993 Mar;175(6):1841-3 [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
pfam04101	Glyco_tran_28_C	5.06e-38	190	356	2	166	Glycosyltransferase family 28 C-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). Structural analysis suggests the C-terminal domain contains the UDP-GlcNAc binding site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOZ32572.1	1.89e-238	1	366	1	366
QIG93769.1	7.71e-238	1	366	1	366
AUC98630.1	1.22e-234	1	366	1	366
QOZ19190.1	7.05e-234	1	366	1	366
QPF83287.1	4.54e-230	1	366	1	366

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3S2U_A	4.86e-53	7	364	5	355	Crystalstructure of the Pseudomonas aeruginosa MurG:UDP-GlcNAc substrate complex [Pseudomonas aeruginosa PAO1]
7D1I_A	3.86e-46	2	363	7	365	ChainA, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_B Chain B, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii],7D1I_C Chain C, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [Acinetobacter baumannii]
1F0K_A	8.83e-42	7	364	9	354	The1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1F0K_B The 1.9 Angstrom Crystal Structure Of E. Coli Murg [Escherichia coli],1NLM_A Crystal Structure Of Murg:glcnac Complex [Escherichia coli],1NLM_B Crystal Structure Of Murg:glcnac Complex [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A5EPK4	2.69e-200	2	366	3	367	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) OX=288000 GN=murG PE=3 SV=1
A4YZK3	1.55e-199	1	366	2	367	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Bradyrhizobium sp. (strain ORS 278) OX=114615 GN=murG PE=3 SV=1
Q89FU7	2.35e-196	1	366	1	366	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110) OX=224911 GN=murG PE=3 SV=1
Q1QNU3	7.40e-194	1	366	1	366	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14) OX=323097 GN=murG PE=3 SV=1
Q211T8	1.26e-193	5	366	6	367	UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase OS=Rhodopseudomonas palustris (strain BisB18) OX=316056 GN=murG PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003733_04333.