CAZyme Information: MGYG000003733_04341

Basic Information

• Species: Bradyrhizobium sp003020075
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Xanthobacteraceae; Bradyrhizobium; Bradyrhizobium sp003020075
• CAZyme ID: MGYG000003733_04341
• CAZy Family: CE11
• CAZyme Description: UDP-3-O-acyl-N-acetylglucosamine deacetylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
320	MGYG000003733_124|CGC2	33681.39	6.2444

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003733	7397431	MAG	Canada	North America

• Gene Location: Start: 11685; End: 12647 Strand: +

Full Sequence      

MKFSRQTTLRSQATVTGVGVHSGLPVSLTLGPAPVDAGFIFVRTGLDGADREVTATADAV
IATEFATVLGDREGPLVSTAEHVLAALRGMGVDNATIEIDGSEVPIMDGSAAAFVAAIDQ
AGIVTQPAVRRFIQVLKPVQVKIGDAMGELRPFAGGFRAEVEIDFANKVIGHQTYSFDLS
PEGFRRDVARARTFGCMNDVARLWGAGFALGASFDNTVVFDEARLLNVEGLRYANECARH
KVLDVIGDLALAGLPLLGSYRSVRGGHKLNNAVLKALLADRSAWRVVESETARRPVRGHV
EAGAGMAGGLVAPAYGPDVS

Enzyme Prediction     

No EC number prediction in MGYG000003733_04341.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE11	6	278	9.3e-100	0.992619926199262

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13186	lpxC	4.42e-151	5	296	3	291	UDP-3-O-acyl-N-acetylglucosamine deacetylase.
pfam03331	LpxC	1.27e-132	6	279	1	271	UDP-3-O-acyl N-acetylglycosamine deacetylase. The enzymes in this family catalyze the second step in the biosynthetic pathway for lipid A.
COG0774	LpxC	2.83e-124	5	293	3	291	UDP-3-O-acyl-N-acetylglucosamine deacetylase [Cell wall/membrane/envelope biogenesis].
TIGR00325	lpxC	2.30e-86	5	290	2	284	UDP-3-0-acyl N-acetylglucosamine deacetylase. UDP-3-O-(R-3-hydroxymyristoyl)-GlcNAc deacetylase from E. coli , LpxC, was previously designated EnvA. This enzyme is involved in lipid-A precursor biosynthesis. It is essential for cell viability. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK13188	PRK13188	1.01e-71	6	277	5	298	bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase/(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUC98622.1	4.24e-221	1	320	1	320
QIG93761.1	1.66e-218	1	320	1	320
QOZ32578.1	2.35e-218	1	320	1	320
QOZ19183.1	5.07e-213	1	320	1	320
QPF83278.1	6.90e-211	1	320	1	320

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5U39_A	1.43e-78	5	293	5	292	Pseudomonasaeruginosa LpxC in complex with CHIR-090 [Pseudomonas aeruginosa PAO1]
4J3D_A	1.52e-78	5	293	3	290	Pseudomonasaeruginosa LpxC in complex with a hydroxamate inhibitor [Pseudomonas aeruginosa PAO1],4J3D_B Pseudomonas aeruginosa LpxC in complex with a hydroxamate inhibitor [Pseudomonas aeruginosa PAO1]
5U3B_A	1.62e-78	5	293	3	290	Pseudomonasaeruginosa LpxC in complex with NVS-LPXC-01 [Pseudomonas aeruginosa PAO1],5U3B_B Pseudomonas aeruginosa LpxC in complex with NVS-LPXC-01 [Pseudomonas aeruginosa PAO1],6MAE_A CHAIN A. UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase PA-LPXC Complexed with (R)-3-((S)-3-(4-(cyclopropylethynyl)phenyl)-2-oxooxazolidin-5-yl)-N-hydroxy-2-methyl-2-(methylsulfonyl)propenamide [Pseudomonas aeruginosa PAO1]
7K99_A	1.84e-78	5	293	3	290	CrystalStructure of P. aeruginosa LpxC with N-Hydroxyformamide inhibitor 19 [Pseudomonas aeruginosa PAO1],7K99_C Crystal Structure of P. aeruginosa LpxC with N-Hydroxyformamide inhibitor 19 [Pseudomonas aeruginosa PAO1],7K9A_A Crystal Structure of P. aeruginosa LpxC with N-Hydroxyformamide inhibitor [Pseudomonas aeruginosa PAO1],7K9A_C Crystal Structure of P. aeruginosa LpxC with N-Hydroxyformamide inhibitor [Pseudomonas aeruginosa PAO1]
6MO4_A	1.84e-78	5	293	7	294	Co-Crystalstructure of P. aeruginosa LpxC-50067 complex [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B2S6P7	5.58e-89	6	289	5	286	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Brucella abortus (strain S19) OX=430066 GN=lpxC PE=3 SV=1
Q8FZP9	5.58e-89	6	289	5	286	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Brucella suis biovar 1 (strain 1330) OX=204722 GN=lpxC PE=3 SV=1
A9M683	5.58e-89	6	289	5	286	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) OX=483179 GN=lpxC PE=3 SV=1
B0CHL2	5.58e-89	6	289	5	286	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) OX=470137 GN=lpxC PE=3 SV=1
Q2YLZ2	5.58e-89	6	289	5	286	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Brucella abortus (strain 2308) OX=359391 GN=lpxC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.984989	0.014945	0.000062	0.000012	0.000009	0.000014

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003733_04341.