CAZyme Information: MGYG000003733_04871

Basic Information

• Species: Bradyrhizobium sp003020075
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Xanthobacteraceae; Bradyrhizobium; Bradyrhizobium sp003020075
• CAZyme ID: MGYG000003733_04871
• CAZy Family: GT25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1883		212241.37	5.1318

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003733	7397431	MAG	Canada	North America

• Gene Location: Start: 7606; End: 13257 Strand: -

Full Sequence      

MIVKNEVANLERCLAAVADHIACWVICDTGSSDGTQDFIKTFFARRNLPGELHTIPFHDF
GQARNDALDRACASELEFDYVLFNDADMELIVDNAEFRKSLSGPGYRLLQRASGGLSYWN
TRLVRRDSGSKYFGVTHEYIDVPGDVVELQGAWYIDHADGSNRGDKSERDIRLLKAALDL
EPDNARYWFYLAWSYRDACQYVEAAAAFAKRADMEGWDEEAWMARLQHARCLRDLGDEDG
FVSKALEAFKQRPTRAEPLYELARYYRERGRYETSLHFSELGLSISAPENDILFIETDVY
QTGLREEFSIAANYSQDAARWDRGYSICNSLALNRAIPDAPRELARTNLFFYLQPAERLF
GSFSARQVDCDVPQGYRPTNPSVSRHGNDLYLVQRTVNFRLLKDGTYETDNGAPIRTRNY
LLRLNADLEVETAAELLLPADFPKTQFEEVQGLEDIRLFSWNGSLWGSSCVRELNAEGWC
EQLIARIEQRSNSETRLAEWLVLRPEGPRLHEKNWMPQAKGASLHFIYSCDPTRIVNDRG
ETVSESDAGFAVEQFRGGTQLIEFDEGWLALVHEVQWQNDRRFYQHRFVWFDSENNLRRL
SRPFYFKEKGVEFAAGLAWHPDGRRLLVSYGVADSESWIASIEAAEVSTALEGNSAPPTA
VSAAPSSQRCENERSNKEPVVKESGLSKPNGKSIGLCMIVKNEAAVIVRCLDSVRPMIDY
VLIEDTGSTDGTQDIIRQWLDSNGLTGEVIDEPWRDFAYNRSHALACLRRNPDVDYALII
DADDALTIEPGFDVAAFKSGMTADLYDVAINHNGIRHHRPQLCSNKKEFYFRGVLHEFVE
APADARGRETASGFAIQIGGGGARSQDPEKYRKDAALLEGALQNETDAFLRSRYTFYLAQ
SYRDCNEPEKALPHYLARAEMGFWQEEVFISLYSAARLKEALDHPEHEVIAAYQRAADSQ
LARAEALHGASRYCRSKGRNKEGADIARRGIDLPMPVGALFAEEWIYEFGLLDEFAVNAF
WAGDYQGCMDACLRILQNPSIDEGLRSRVEDNLRFAKDRISERVELPNALNEPDGNRPLP
KVLIAILAKSKAGHLPLFLDCIEALDYPSERIALHVRTNNNRDDTAEILRDWLQRVGSRY
SHVELDDSNVSERVQDFADHEWNATRFSVLGRIRQHSMNQTLALGCDYYFVVDVDNYLRP
LTLRHLVELNLPIVAPLLKCVDADRPLYSNYHQKIDANGYFLPSDEYNTILSRSSPGLHE
VPVVHCTYLVRADAIPQLTYDDGSGRYEYVVFADSARRAGISQILDTREVYGWLTFASDG
EAIRPLIAGELAAKPAREAPRKDTVPASDGKRAIRLKEYPANASFSHTPSDEYVQSRNHT
LVRKPYLLETDALGFIRGSKSPTTAAQTVIVLGDSVVEGMYLDPDDRFCAKLETILRSEN
AVDVIVRNGGYSGATTLHMLNLFLNKIIPLKPDVVILMTGIVDVDVANLESSFWSRDCWL
EPIVDLNANNSWRDQNLLSAPNVADRRRLLDLFSLAARSFGIELWFATIPHLRDESIDPG
IARTRVLINETTRAAARSGEHALCDLEAQLAGRTDIFQDAFHLNPIGAEAAARSIVSNGL
GSYLLAKGSNAPFRAAQKNKQSANAIHVINLDRSTARWDKFRSRNAKLGNFERVSAIDGR
KLDRLDLERQGLIAPELDYSAGALGCALSHIQLWQKAASQDQPLTIFEDDALSHPVFDEH
RLAVLAQLPTDWDIILWGFIYDPLFLWIDLGFSASEMRFYDRTEPFTWSDTSDGRPIYHP
HRLRHAYGTQAYSISPRGARRLLGSVLPLKKQFVPFPGTSIVDQDQGIDGAMNLAYPTLQ
SYVCIPPLVVQRDDGVSDRLSTK

Enzyme Prediction     

No EC number prediction in MGYG000003733_04871.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT25	1646	1826	1.4e-27	0.9171270718232044

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02511	Beta4Glucosyltransferase	1.33e-25	1	189	6	198	UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.
cd02511	Beta4Glucosyltransferase	4.23e-25	694	842	2	150	UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.
cd06532	Glyco_transf_25	4.34e-24	1646	1743	2	101	Glycosyltransferase family 25 [lipooligosaccharide (LOS) biosynthesis protein] is a family of glycosyltransferases involved in LOS biosynthesis. The members include the beta(1,4) galactosyltransferases: Lgt2 of Moraxella catarrhalis, LgtB and LgtE of Neisseria gonorrhoeae and Lic2A of Haemophilus influenzae. M. catarrhalis Lgt2 catalyzes the addition of galactose (Gal) to the growing chain of LOS on the cell surface. N. gonorrhoeae LgtB and LgtE link Gal-beta(1,4) to GlcNAc (N-acetylglucosamine) and Glc (glucose), respectively. The genes encoding LgtB and LgtE are two genes of a five gene locus involved in the synthesis of gonococcal LOS. LgtE is believed to perform the first step in LOS biosynthesis.
COG3306	COG3306	1.05e-23	1646	1880	5	245	Glycosyltransferase involved in LPS biosynthesis, GR25 family [Cell wall/membrane/envelope biogenesis].
pfam01755	Glyco_transf_25	6.45e-21	1646	1823	4	186	Glycosyltransferase family 25 (LPS biosynthesis protein). Members of this family belong to Glycosyltransferase family 25 This is a family of glycosyltransferases involved in lipopolysaccharide (LPS) biosynthesis. These enzymes catalyze the transfer of various sugars onto the growing LPS chain during its biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIG91112.1	0.0	1	1881	1	1881
QPC91649.1	7.48e-287	693	1879	3	924
QKC78801.1	1.17e-284	693	1882	3	928
BCG75284.1	1.99e-284	1	713	11	749
BAV51039.1	1.99e-284	1	713	11	749

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FXK_A	3.43e-15	1075	1325	268	505	CrystalStructure of full-length Human Lysyl Hydroxylase LH3 [Homo sapiens],6FXM_A Crystal Structure of full-length Human Lysyl Hydroxylase LH3 - Cocrystal with Mn2+ [Homo sapiens],6FXR_A Crystal Structure of full-length Human Lysyl Hydroxylase LH3 - Cocrystal with Fe2+, Mn2+, UDP-Gal [Homo sapiens],6FXT_A Crystal Structure of full-length Human Lysyl Hydroxylase LH3 - Cocrystal with Fe2+, Mn2+, UDP-Glc [Homo sapiens],6FXX_A Crystal Structure of full-length Human Lysyl Hydroxylase LH3 - Cocrystal with Fe2+, Mn2+, UDP-Gal, Hg2+ Soak [Homo sapiens],6FXY_A Crystal Structure of full-length Human Lysyl Hydroxylase LH3 - Cocrystal with Fe2+, Mn2+, UDP-Gal - Structure from long-wavelength S-SAD [Homo sapiens],6TE3_A Chain A, Procollagen-lysine,2-oxoglutarate 5-dioxygenase 3 [Homo sapiens],6TEC_A Chain A, Procollagen-lysine,2-oxoglutarate 5-dioxygenase 3 [Homo sapiens],6TES_A Chain A, Procollagen-lysine,2-oxoglutarate 5-dioxygenase 3 [Homo sapiens]
6TEU_A	3.43e-15	1075	1325	268	505	ChainA, Multifunctional procollagen lysine hydroxylase and glycosyltransferase LH3 [Homo sapiens],6TEX_A Chain A, Multifunctional procollagen lysine hydroxylase and glycosyltransferase LH3 [Homo sapiens],6TEZ_A Chain A, Multifunctional procollagen lysine hydroxylase and glycosyltransferase LH3 [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8IYK4	6.38e-36	1033	1314	13	292	Procollagen galactosyltransferase 2 OS=Homo sapiens OX=9606 GN=COLGALT2 PE=1 SV=1
A0JPH3	3.11e-34	1073	1314	34	280	Procollagen galactosyltransferase 1-A OS=Xenopus laevis OX=8355 GN=colgalt1-a PE=2 SV=1
Q6NVG7	6.38e-34	1073	1314	45	291	Procollagen galactosyltransferase 2 OS=Mus musculus OX=10090 GN=Colgalt2 PE=2 SV=2
Q5U483	5.56e-33	1080	1314	41	280	Procollagen galactosyltransferase 1-B OS=Xenopus laevis OX=8355 GN=colgalt1-b PE=2 SV=1
Q7Q021	4.61e-32	1071	1362	15	293	Glycosyltransferase 25 family member OS=Anopheles gambiae OX=7165 GN=AGAP012208 PE=3 SV=4

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003733_04871.