CAZyme Information: MGYG000003733_06398

Basic Information

• Species: Bradyrhizobium sp003020075
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Xanthobacteraceae; Bradyrhizobium; Bradyrhizobium sp003020075
• CAZyme ID: MGYG000003733_06398
• CAZy Family: GT51
• CAZyme Description: Biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
246		26982.37	11.0313

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003733	7397431	MAG	Canada	North America

• Gene Location: Start: 1965; End: 2705 Strand: +

Full Sequence      

MPAVSRRAGAKSLLERSSPETLVLRIVRILLLVLLAVLLLPYLVTPFYRTGQPVSALMAW
RTLRGAPVTRHWVDFGAMSPYLPRSVVSSEDAHFCKHRGVDWGALREAVNDAEDGEVARG
GSTITQQVAKNLFLWSGRSVIRKGLELPLALWIDFVLPKQRILEIYLNIAEMGPAGQFGA
EAGAQYAFGRSAAALSPREAALLAAILPNPLKRSARNPGPGVRRLSGTYMARANTVTRCW
RDNRGD

Enzyme Prediction     

No EC number prediction in MGYG000003733_06398.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	69	217	1.2e-44	0.8361581920903954

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00056	mtgA	1.34e-103	51	244	34	236	monofunctional biosynthetic peptidoglycan transglycosylase; Provisional
TIGR02070	mono_pep_trsgly	1.98e-65	53	224	31	209	monofunctional biosynthetic peptidoglycan transglycosylase. This family is one of the transglycosylases involved in the late stages of peptidoglycan biosynthesis. Members tend to be small, about 240 amino acids in length, and consist almost entirely of a domain described by pfam00912 for transglycosylases. Species with this protein will have several other transglycosylases as well. All species with this protein are Proteobacteria that produce murein (peptidoglycan). [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	3.00e-63	59	236	65	236	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	6.78e-58	70	218	13	158	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG5009	MrcA	3.79e-31	70	218	67	212	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBB95699.1	8.31e-147	7	245	4	242
QOZ38512.1	3.10e-143	30	245	2	217
AUC93653.1	4.14e-140	25	245	2	222
QOZ21284.1	1.19e-139	25	245	2	222
QIG95865.1	9.73e-139	25	245	2	222

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NB6_A	6.35e-23	70	212	20	162	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
2OQO_A	2.43e-22	70	212	20	162	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
4OON_A	2.20e-16	85	218	54	184	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
5U2G_A	1.01e-15	87	218	57	185	2.6Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20],5U2G_B 2.6 Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20]
7U4H_A	8.48e-15	73	214	43	182	ChainA, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX],7U4H_B Chain B, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q89VU8	4.90e-117	25	244	2	224	Biosynthetic peptidoglycan transglycosylase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110) OX=224911 GN=mtgA PE=3 SV=2
Q1QQI5	1.84e-110	25	245	3	225	Biosynthetic peptidoglycan transglycosylase OS=Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14) OX=323097 GN=mtgA PE=3 SV=1
Q3SVC8	1.74e-108	25	244	3	224	Biosynthetic peptidoglycan transglycosylase OS=Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255) OX=323098 GN=mtgA PE=3 SV=1
B3QBD2	8.98e-104	17	244	7	234	Biosynthetic peptidoglycan transglycosylase OS=Rhodopseudomonas palustris (strain TIE-1) OX=395960 GN=mtgA PE=3 SV=1
Q6NCE7	8.98e-104	17	244	7	234	Biosynthetic peptidoglycan transglycosylase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) OX=258594 GN=mtgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000014	0.000049	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
26	48