CAZyme Information: MGYG000003733_06638

Basic Information

• Species: Bradyrhizobium sp003020075
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Xanthobacteraceae; Bradyrhizobium; Bradyrhizobium sp003020075
• CAZyme ID: MGYG000003733_06638
• CAZy Family: CE1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
401	MGYG000003733_359|CGC1	42352.13	7.1133

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003733	7397431	MAG	Canada	North America

• Gene Location: Start: 34; End: 1239 Strand: -

Full Sequence      

MSLVNNIEFLRHLPKMNAFNGLGALAPAVPTPLVETTEFGANPGALKMFSYVPEQLARSP
ALVVVLHGCGQTAASYDLGAGWSTLARHYGFALLMPEQQSANNGNTCFNWFDPEDIARGQ
GEAASIREMVGHLAGAHKIDPRRIFVTGLSAGGAMTTVMLATYPDVFAAGAVIAGLPFGV
AGNLREALGGMMQGSALSAPELGDRVRAASKHKGDWPRISVWHGSADRTVHPGNADAIVR
QWLDLHGLPLAAMSRADVDGHPREVWWNADGETLVESYSITDMAHGTPLGLAGNDERYGV
EGAFLIEAGISSSYHIASFFGLTDQVRQPQIAPTGVPRENADTISMTIPVPAGKPEPVAV
RSSGRPGKKQARQQGKPRSKGVDVGGVITRALTAAGLMKQP

Enzyme Prediction     

No EC number prediction in MGYG000003733_06638.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	47	266	1.3e-24	0.8942731277533039

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR01840	esterase_phb	3.64e-90	48	260	1	212	esterase, PHB depolymerase family. This model describes a subfamily among lipases of the ab-hydrolase family. This subfamily includes bacterial depolymerases for poly(3-hydroxybutyrate) (PHB) and related polyhydroxyalkanoates (PHA), as well as acetyl xylan esterases, feruloyl esterases, and others from fungi. [Fatty acid and phospholipid metabolism, Degradation]
COG3509	LpqC	5.05e-66	32	323	33	307	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
pfam10503	Esterase_phd	5.03e-41	51	260	6	213	Esterase PHB depolymerase. This family of proteins include acetyl xylan esterases (AXE), feruloyl esterases (FAE), and poly(3-hydroxybutyrate) (PHB) depolymerases.
COG1506	DAP2	2.16e-10	27	249	358	583	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].
COG4099	COG4099	7.53e-10	46	175	174	302	Predicted peptidase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBB95640.1	2.39e-243	1	400	1	392
QPF85257.1	2.69e-233	1	399	1	393
SDT32486.1	3.26e-194	1	399	1	401
QHO73290.1	2.87e-193	1	399	1	403
ANV99019.1	4.07e-193	1	399	1	403

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5X6S_A	8.45e-32	33	289	4	263	Acetylxylan esterase from Aspergillus awamori [Aspergillus awamori],5X6S_B Acetyl xylan esterase from Aspergillus awamori [Aspergillus awamori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P52090	1.10e-83	33	322	38	327	Poly(3-hydroxyalkanoate) depolymerase C OS=Paucimonas lemoignei OX=29443 GN=phaZ1 PE=3 SV=1
G2QND5	1.68e-36	16	266	3	254	Feruloyl esterase B OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Fae1a PE=1 SV=1
Q5B037	4.43e-36	30	274	27	277	Acetylxylan esterase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=axeA PE=1 SV=2
A8PB24	5.21e-36	23	288	91	360	Acetylxylan esterase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) OX=240176 GN=CC1G_12850 PE=1 SV=1
Q9HGR3	6.64e-35	33	288	21	278	Feruloyl esterase B OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=fae-1 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003733_06638.