CAZyme Information: MGYG000003734_00989

Basic Information

• Species: Afipia broomeae
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Xanthobacteraceae; Afipia; Afipia broomeae
• CAZyme ID: MGYG000003734_00989
• CAZy Family: CBM50
• CAZyme Description: Beta-barrel assembly-enhancing protease

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
596		65680.38	7.8986

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003734	5238503	MAG	Canada	North America

• Gene Location: Start: 1108; End: 2898 Strand: -

Full Sequence      

MILQRRFSRVAVATFAFASVLASAGPIAAQTRTSASEDTKQGTYPSGRDLLGLTVSGSYL
AARHASVDRDATAAAAFYRAALRSDPKNNELLDRAFIASLADGDIDEAVKLADRILTIDK
NNRVARLVAGVRSLKQKQYGAAQQNINQSVRGPITDLVATLLSGWASYGAGNTQAAINAI
DKLAGPEWYPIFKDLHSGMILELANKQKEAGVRFERAYKLDDSALRVSDAYARWLSRNKD
AAAATAIYEGFDKKLARHPLVVEGIRETKAGKKLSPLAENPQQGAAEALYGIGASLTRRG
GEDLALVYLQLALYLNPNHSLALLSLADLYESVKKPQMAIKVYERVPATSPLKRNAQIQL
ATDLDAVDRTDEGIKILNAVVADDPKDVEAIMALGNIQRARKKFADCGETYSKGIEAQSG
AEKQNWVLYYFRGICFERSKQWAKAETDLKKALEMQPEQPHVLNYLGYSWIDQGVNLDEA
MKMIRRAVDQRPDDGYIVDSLGWAYYRIADYENAVKHLERAIDLKPEDPTINDHLGDAYW
RVGRTLEAKFQWAHARDLKPEAEELPKIEAKLRDGLPEDTSNAAAAEKKKEDGRGG

Enzyme Prediction     

No EC number prediction in MGYG000003734_00989.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02917	PEP_TPR_lipo	2.19e-22	82	549	356	891	putative PEP-CTERM system TPR-repeat lipoprotein. This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.
TIGR02917	PEP_TPR_lipo	4.63e-15	82	548	220	755	putative PEP-CTERM system TPR-repeat lipoprotein. This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.
sd00006	TPR	4.78e-14	428	523	3	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
TIGR02917	PEP_TPR_lipo	1.39e-12	334	561	139	395	putative PEP-CTERM system TPR-repeat lipoprotein. This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.
TIGR02917	PEP_TPR_lipo	1.06e-11	264	591	137	460	putative PEP-CTERM system TPR-repeat lipoprotein. This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system, analogous to the LPXTG/sortase system common in Gram-positive bacteria. This protein occurs in a species if and only if a transmembrane histidine kinase (TIGR02916) and a DNA-binding response regulator (TIGR02915) also occur. The present of tetratricopeptide repeats (TPR) suggests protein-protein interaction, possibly for the regulation of PEP-CTERM protein expression, since many PEP-CTERM proteins in these genomes are preceded by a proposed DNA binding site for the response regulator.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCP52622.1	1.85e-116	45	512	37	508
BCH26208.1	3.61e-107	4	513	3	508
BCH34192.1	3.61e-107	4	513	3	508
AWC25107.1	6.46e-105	56	513	40	504
QDZ00464.1	1.42e-104	54	512	38	503

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7RQF_A	8.10e-09	325	512	279	465	ChainA, TPR repeat-containing protein PA4667 [Pseudomonas aeruginosa PAO1],7RQF_B Chain B, TPR repeat-containing protein PA4667 [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42810	1.56e-08	325	512	342	528	TPR repeat-containing protein PA4667 OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=PA4667 PE=4 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000695	0.998001	0.000592	0.000286	0.000202	0.000170

TMHMM  Annotations     

start	end
7	29