CAZyme Information: MGYG000003734_01280

Basic Information

• Species: Afipia broomeae
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Xanthobacteraceae; Afipia; Afipia broomeae
• CAZyme ID: MGYG000003734_01280
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
871	MGYG000003734_15|CGC1	98003.86	6.3673

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003734	5238503	MAG	Canada	North America

• Gene Location: Start: 40247; End: 42862 Strand: +

Full Sequence      

MKVRDLVRDTEWIPGSDYVDGHKPAISVLLPTFRRGASGLFRKAVKSVLGQTLHDLELII
VDDASTDGTADQIAEFMREDGRVSCLRHPNNIGLPAVSEFEAFMKARADYIAFAFDDDFF
YPDALEKLLERSLDNPRRVCFGNVTWREREKDSTVIQSGKLGGPLTYHNIRSWNSIPNCA
VLLPRAVIDDVGFYDPHILMTRICDWDLWRRIGERYLLHHVDVEVGEVTGPETDDSLGKT
YGLFSDAAEERMRVSHRVLKTSAYLNLDVFSKDSELSDLTNLTIRDLAAEHASKRPLLFG
EVSIQNSMQDKEIIVLTPSHDASTLLCFDYLPLQARGKVRVILSQGGFAISELAHASCVI
VVRLLDAHADWIQAARKLGIPTYYFLDDNLPELIAAKELKAPEDFSISSLRTKLRDFAGV
LLSSSQLVSYFEANLIHPNLYVFPVSYAVAPPRFLGQRREAGFDLVVASIGGKHRQRGLI
DCVLPGLQQLASEGMRVHFVIGGAFPADYNDLLEKVSSYEALKVTLLPFDVDLSRAQMQL
AEYRPDLLLHAPNKTLNNKYKTLNVALSAYILDCVLIVPNDPPYDLVEFDGAAVRVEPAN
EPGAWLQAVRNLLSKRETWDGYKKANATFCRTQFSGEQNLVVLNEILQSSPAISPALVET
RLKELYLSKSVSAGNNLFDSEPLRASLLQLSQFRAQTRRNQRYRPHRPREDIWPRISPAF
EDIRQHVLKNKIRSSSSYLELSDSLHDVAYAEYPIHIEKGQLKSMTCALSSEGIHSGLVG
VELVAPNDTIAVQSSRDLAPLNLHLPVTFDLKNTVVQEGIWKFRFFARSEWPLYILEFAE
YSRFGWSRRVIAPFMKIEYAGQAETGARSTM

Enzyme Prediction     

No EC number prediction in MGYG000003734_01280.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	27	159	4.8e-23	0.7647058823529411

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00535	Glycos_transf_2	1.88e-23	27	152	1	123	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd06433	GT_2_WfgS_like	3.37e-21	27	226	1	191	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd00761	Glyco_tranf_GTA_type	4.66e-20	28	221	1	156	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
COG0463	WcaA	2.49e-17	22	224	1	204	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd04196	GT_2_like_d	3.23e-17	27	191	1	167	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPC94097.1	0.0	1	866	1	870
QBR33177.1	2.85e-231	1	857	1	855
QXI10365.1	5.14e-223	1	857	1	854
QHF52062.1	1.31e-220	1	856	1	853
EGJ49366.1	2.43e-93	1	663	1	650

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1H7L_A	8.70e-10	24	225	1	210	dTDP-MAGNESIUMCOMPLEX OF SPSA FROM BACILLUS SUBTILIS [Bacillus subtilis],1H7Q_A dTDP-MANGANESE COMPLEX OF SPSA FROM BACILLUS SUBTILIS [Bacillus subtilis],1QG8_A Native (Magnesium-Containing) Spsa From Bacillus Subtilis [Bacillus subtilis],1QGQ_A Udp-manganese Complex Of Spsa From Bacillus Subtilis [Bacillus subtilis],1QGS_A Udp-Magnesium Complex Of Spsa From Bacillus Subtilis [Bacillus subtilis]
2Z86_A	3.20e-07	24	222	375	565	Crystalstructure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_C Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_D Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli]
2Z87_A	3.20e-07	24	222	374	564	Crystalstructure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli],2Z87_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli]
5HEA_A	1.84e-06	26	180	7	157	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q57022	2.10e-11	24	193	4	168	Uncharacterized glycosyltransferase HI_0868 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_0868 PE=3 SV=1
O32268	7.73e-10	23	130	5	109	Putative teichuronic acid biosynthesis glycosyltransferase TuaG OS=Bacillus subtilis (strain 168) OX=224308 GN=tuaG PE=2 SV=1
Q0P9C6	3.45e-09	24	160	2	134	GalNAc(5)-diNAcBac-PP-undecaprenol beta-1,3-glucosyltransferase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) OX=192222 GN=pglI PE=1 SV=1
P39621	4.82e-09	24	225	2	211	Spore coat polysaccharide biosynthesis protein SpsA OS=Bacillus subtilis (strain 168) OX=224308 GN=spsA PE=1 SV=1
Q9CMP0	4.59e-08	24	256	433	663	Chondroitin synthase OS=Pasteurella multocida (strain Pm70) OX=272843 GN=fcbD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003734_01280.