CAZyme Information: MGYG000003734_01974

Basic Information

• Species: Afipia broomeae
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Xanthobacteraceae; Afipia; Afipia broomeae
• CAZyme ID: MGYG000003734_01974
• CAZy Family: GT51
• CAZyme Description: Biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
224	MGYG000003734_27|CGC1	24689.63	8.9901

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003734	5238503	MAG	Canada	North America

• Gene Location: Start: 25656; End: 26330 Strand: -

Full Sequence      

MRRLIRMVLLVVLGLVLLPYVLTPLYSSGHPVSTLMIGRYLAGETVTRKWVDLDEMSEAL
PRSVVAAEDAKFCFHHGIDWDSVRNIIEDAQDGEVARGGSTITQQVAKNLFLWPGRSVVR
KALEFPLAMWIDLVLSKKRILELYLNMAELGPDGQFGAEAGANYAFGRPAAALSAREAAL
LASILPNPVTRSARNPGPGVRRMAGTYVVRAQSAEISDCWERNR

Enzyme Prediction     

No EC number prediction in MGYG000003734_01974.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	46	195	4.3e-46	0.8418079096045198

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00056	mtgA	1.73e-91	29	224	34	236	monofunctional biosynthetic peptidoglycan transglycosylase; Provisional
TIGR02070	mono_pep_trsgly	4.54e-56	31	204	31	211	monofunctional biosynthetic peptidoglycan transglycosylase. This family is one of the transglycosylases involved in the late stages of peptidoglycan biosynthesis. Members tend to be small, about 240 amino acids in length, and consist almost entirely of a domain described by pfam00912 for transglycosylases. Species with this protein will have several other transglycosylases as well. All species with this protein are Proteobacteria that produce murein (peptidoglycan). [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	9.83e-51	25	204	47	233	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	5.61e-48	48	169	13	134	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG5009	MrcA	5.15e-28	48	169	67	188	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABE61512.1	1.84e-115	1	224	1	224
SHI10952.1	5.19e-113	3	224	4	225
SHG29100.1	6.87e-113	3	224	2	223
ABD05226.1	7.36e-113	1	223	1	224
ABE37550.1	2.26e-112	1	223	1	223

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NB6_A	1.26e-24	48	184	20	156	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
2OQO_A	4.89e-24	48	184	20	156	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
5U2G_A	3.96e-17	51	202	43	191	2.6Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20],5U2G_B 2.6 Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20]
4OON_A	5.30e-17	63	196	54	184	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
5FGZ_A	1.48e-15	48	185	156	297	E.coli PBP1b in complex with FPI-1465 [Escherichia coli K-12],5HL9_A E. coli PBP1b in complex with acyl-ampicillin and moenomycin [Escherichia coli K-12],5HLA_A E. coli PBP1b in complex with acyl-cephalexin and moenomycin [Escherichia coli K-12],5HLB_A E. coli PBP1b in complex with acyl-aztreonam and moenomycin [Escherichia coli K-12],5HLD_A E. coli PBP1b in complex with acyl-CENTA and moenomycin [Escherichia coli K-12],6YN0_A Structure of E. coli PBP1b with a FtsN peptide activating transglycosylase activity [Escherichia coli K-12],7LQ6_A Chain A, Penicillin-binding protein 1B [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1QQI5	3.67e-116	1	224	1	224	Biosynthetic peptidoglycan transglycosylase OS=Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14) OX=323097 GN=mtgA PE=3 SV=1
Q2J2T4	1.47e-113	1	223	1	224	Biosynthetic peptidoglycan transglycosylase OS=Rhodopseudomonas palustris (strain HaA2) OX=316058 GN=mtgA PE=3 SV=1
Q13ED9	4.52e-113	1	223	1	223	Biosynthetic peptidoglycan transglycosylase OS=Rhodopseudomonas palustris (strain BisB5) OX=316057 GN=mtgA PE=3 SV=1
Q3SVC8	6.72e-112	1	224	1	224	Biosynthetic peptidoglycan transglycosylase OS=Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255) OX=323098 GN=mtgA PE=3 SV=1
Q6NCE7	9.04e-110	2	224	12	234	Biosynthetic peptidoglycan transglycosylase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) OX=258594 GN=mtgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.792110	0.201904	0.003615	0.000442	0.000327	0.001631

TMHMM  Annotations     

start	end
7	29