CAZyme Information: MGYG000003734_03632

Basic Information

• Species: Afipia broomeae
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Xanthobacteraceae; Afipia; Afipia broomeae
• CAZyme ID: MGYG000003734_03632
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
377		40417	9.0077

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003734	5238503	MAG	Canada	North America

• Gene Location: Start: 6091; End: 7224 Strand: -

Full Sequence      

MAIWVYLIVARGDFWRTQKFDDLAPAPGFMNWPPIAVVVPARDEAAGVGACVTSILSQPY
PGALSMILVDDQSQDGTSQIASEAAAKIGASDRLTVLQGRPLPSGWTGKLWAVKQGLTLV
ESSATQPEYVLLTDADIVYSGDVLMRLVARAQNEKLAMTSIMAKLRCESLAEKYLIPAFI
FFFGMLYPFGWVRSRTRATGAAAGGCILARWDALKNAGGIDAIRGSLIDDCALGVRLKTQ
GPVWLGFSQNVVSVRASDTVGDVGQMISRSAYAQLHYSLALLIGTIFAMTIVFLAPVLIS
LFGHGLAAVFAAAAWLLMALAFQPTLRYYGQSALWGPALPAIAVAYMVFTVNSAIQHFQG
RGGMWKGRAQAQVSSSQ

Enzyme Prediction     

No EC number prediction in MGYG000003734_03632.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	33	241	7e-23	0.8565217391304348

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR03469	HpnB	3.24e-161	1	372	9	384	hopene-associated glycosyltransferase HpnB. This family of genes include a glycosyl transferase, group 2 domain (pfam00535) which are responsible, generally for the transfer of nucleotide-diphosphate sugars to substrates such as polysaccharides and lipids. The genes of this family are often found in the same genetic locus with squalene-hopene cyclase genes, and are never associated with genes for the metabolism of phytoene. Indeed, the members of this family appear to never be found in a genome lacking squalene-hopene cyclase (SHC), although not all genomes encoding SHC have this glycosyl transferase. In the organism Zymomonas mobilis the linkage of this gene to hopanoid biosynthesis has been noted and the gene named HpnB. Hopanoids are known to feature polar glycosyl head groups in many organisms.
cd06423	CESA_like	1.15e-17	37	230	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
COG1215	BcsA	6.24e-17	1	241	22	251	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06439	CESA_like_1	1.73e-16	5	155	8	138	CESA_like_1 is a member of the cellulose synthase (CESA) superfamily. This is a subfamily of cellulose synthase (CESA) superfamily. CESA superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members of the superfamily include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins.
pfam00535	Glycos_transf_2	8.53e-15	37	154	2	106	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADP72225.1	6.05e-137	1	372	12	383
CBW76993.1	2.13e-136	1	371	10	382
QUD87906.1	8.32e-134	1	371	12	380
ADJ22294.1	1.06e-132	1	373	12	385
BAP89644.1	1.88e-131	2	371	15	381

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q3MB01	4.78e-06	33	161	106	225	Beta-monoglucosyldiacylglycerol synthase OS=Trichormus variabilis (strain ATCC 29413 / PCC 7937) OX=240292 GN=Ava_2217 PE=1 SV=1
Q8YMK0	6.35e-06	33	161	106	225	Beta-monoglucosyldiacylglycerol synthase OS=Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) OX=103690 GN=all4933 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000001	0.000017	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
174	192
277	299
304	326
333	355