CAZyme Information: MGYG000003734_04014

Basic Information

• Species: Afipia broomeae
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Xanthobacteraceae; Afipia; Afipia broomeae
• CAZyme ID: MGYG000003734_04014
• CAZy Family: GH103
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
271		29864.79	8.4521

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003734	5238503	MAG	Canada	North America

• Gene Location: Start: 5055; End: 5870 Strand: +

Full Sequence      

MTVGFLLRAAFAAFIVLVPASWASAATCGTGSFESWLDNFKKEAAAEGISQQAISQGLNG
VTLDNTVLSRDRSQHVFRQSFEEFSGRMIPPRLAVGANKMKQFGSVLSRIEQRYGVPGSV
LVAIWGLETDYGVNIGKFPTIRSVATLAYDCRRSEMFRAELKDALRIVDQGDLSPTDMRG
AWAGEIGQTQFMPSSYIKFAVDFDGNGRRDLLRSAPDVLASTANFLASHGWKRGQPWDPG
SENFAVIQQWNKSEVYSKTIAYFANQLDRAP

Enzyme Prediction     

No EC number prediction in MGYG000003734_04014.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH103	33	237	2.5e-79	0.6949152542372882

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02283	MltB_2	2.93e-114	32	268	1	299	lytic murein transglycosylase. Members of this family are closely related to the MltB family lytic murein transglycosylases described by TIGR02282 and are likewise all proteobacterial, although that family and this one form clearly distinct clades. Several species have one member of each family. Many members of this family (unlike the MltB family) contain an additional C-terminal domain, a putative peptidoglycan binding domain (pfam01471), not included in region described by this model. Many sequences appear to contain N-terminal lipoprotein attachment sites, as does E. coli MltB in TIGR02282. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
pfam13406	SLT_2	4.62e-109	32	264	1	291	Transglycosylase SLT domain. This family is related to the SLT domain pfam01464.
COG2951	MltB	4.87e-97	5	271	13	339	Membrane-bound lytic murein transglycosylase B [Cell wall/membrane/envelope biogenesis].
TIGR02282	MltB	2.57e-53	39	236	2	202	lytic murein transglycosylase B. This family consists of lytic murein transglycosylases (murein hydrolases) in the family of MltB, which is a membrane-bound lipoprotein in Escherichia coli. The N-terminal lipoprotein modification motif is conserved in about half the members of this family. The term Slt35 describes a naturally occurring soluble fragment of MltB. Members of this family never contain the putative peptidoglycan binding domain described by pfam01471, which is associated with several classes of bacterial cell wall lytic enzymes. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
PRK10760	PRK10760	1.00e-35	90	236	122	268	murein hydrolase B; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWG10926.1	4.72e-150	6	271	6	271
SHH35285.1	1.74e-149	1	271	6	278
QWG16235.1	5.50e-149	6	271	6	271
QWG21137.1	1.24e-147	6	271	6	270
SHH30077.1	2.60e-147	7	271	7	271

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5ANZ_A	4.45e-56	18	237	34	253	CrystalStructure of SltB3 from Pseudomonas aeruginosa. [Pseudomonas aeruginosa],5AO7_A Crystal Structure of SltB3 from Pseudomonas aeruginosa in complex with NAG-anhNAM-pentapeptide [Pseudomonas aeruginosa]
5AO8_A	4.45e-56	18	237	34	253	CrystalStructure of SltB3 from Pseudomonas aeruginosa in complex with NAG-NAM-pentapeptide [Pseudomonas aeruginosa]
5O8X_A	2.96e-29	92	236	65	210	TheX-ray Structure of Catenated Lytic Transglycosylase SltB1 from Pseudomonas aeruginosa [Pseudomonas aeruginosa],5O8X_B The X-ray Structure of Catenated Lytic Transglycosylase SltB1 from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
4ANR_A	4.05e-29	92	236	82	227	Crystalstructure of soluble lytic Transglycosylase SltB1 from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
1LTM_A	7.61e-25	90	234	83	227	AcceleratedX-ray Structure Elucidation Of A 36 Kda Muramidase/transglycosylase Using Warp [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P41052	7.45e-24	90	234	124	268	Membrane-bound lytic murein transglycosylase B OS=Escherichia coli (strain K12) OX=83333 GN=mltB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000329	0.998950	0.000218	0.000153	0.000156	0.000157

TMHMM  Annotations     

start	end
5	27