CAZyme Information: MGYG000003734_04531

Basic Information

• Species: Afipia broomeae
• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Xanthobacteraceae; Afipia; Afipia broomeae
• CAZyme ID: MGYG000003734_04531
• CAZy Family: GH102
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
574		62802.32	10.0791

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003734	5238503	MAG	Canada	North America

• Gene Location: Start: 6152; End: 7876 Strand: +

Full Sequence      

MGRKADSNDVAAPGARAGRFGAWLKAGTAGLCAAAFVLADAQARASRHTSHEHHEHQRRG
PVVWPLEFPGAQYAPLKWSEVAGWTDDDPLPAFKTFRASCKPIAAQKAPLAESKALGTSL
RDSCIAARAEDISDSAKAREFFEKNFTPLLISRIGEDAGFVTGYYEPIVDGSRVQTDVYN
VPVYRRPSNLFVRGYSQANSSMPNKGQVFRKIGRRKLVPYYDRAEIEDGAIAGRGLEVVW
LKSQTDLLFIQIQGSARVKLEDGSVVRINYDAHNGFPYMPVGRILIERNIIPKDQMSMQK
IREYMEQSPDAAKELRRQNRSYVFFREVKLGADDEAVGAQGVPLTAGRSIAVDKSLHVYG
TPFFIEGNLPIESDTSNTPFRRLMIAQDTGSAIIGPARADIYFGAGADAGRVAGRLKNPA
RFVMLLPNSLDPVARGRTMPLPEDRPSATIAKLFPQTEPEKQPVKETPKEAAKDAPKETV
KEAAKEQPKTESKTEAKTEPKAVPKDPPVDTNKTAAPKEQPAAPTPPAATAAPVAQAVPL
PEARPKAAPEATPATVKSDTPRRSKHHRRTRHRQ

Enzyme Prediction     

No EC number prediction in MGYG000003734_04531.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH102	170	326	4.5e-55	0.9872611464968153

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2821	MltA	6.87e-107	81	435	18	373	Membrane-bound lytic murein transglycosylase [Cell wall/membrane/envelope biogenesis].
pfam03562	MltA	2.42e-104	84	326	1	231	MltA specific insert domain. This beta barrel domain is found inserted in the MltA a murein degrading transglycosylase enzyme. This domain may be involved in peptidoglycan binding.
smart00925	MltA	1.28e-72	168	326	1	153	MltA specific insert domain. This beta barrel domain is found inserted in the MltA a murein degrading transglycosylase enzyme. This domain may be involved in peptidoglycan binding.
cd14668	mlta_B	2.07e-70	169	328	1	159	Domain B insert of mltA_like lytic transglycosylases. Escherichia coli MltA is a membrane-bound lytic transglycosylase comprised of two domains separated by a large groove, where the peptidoglycan strand binds. Domain A is made up of an N-terminal and a C-terminal portion, which correspond to the 3D domain, named for 3 conserved aspartate residues. Domain B is inserted within the linear sequence of domain A. MltA is distinct from other bacterial lytic transglycosylases (LTs), which are similar to each other. Escherichia coli peptidoglycan lytic transglycosylase (LT) initiates cell wall recycling in response to damage, during bacterial fission, and cleaves peptidoglycan (PG) to create functional spaces in its wall. PG chains (also known as murein), the major components of the bacterial cell wall, are comprised of alternating beta-1-4-linked N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), and lytic transglycosylases cleave this beta-1-4 bond. Typically, peptidoglycan lytic transglycosylases (LT) are exolytic, releasing Metabolite 1 (GlcNAc-anhMurNAc-L-Ala-D-Glu-m-Dap-D-Ala-D-Ala) from the ends of the PG strands. In contrast, MltE is endolytic , cleaving in the middle of PG strands, with further processing to Metabolite 1 accomplished by other LTs. In E. coli, there are six membrane-bound LTs: MltA-MltF and soluble Slt70. Slt35 is a soluble fragment cleaved from MltB. Bacterial LTs are classified in 4 families: Family 1 includes slt70 MltC-MltF, Family 2 includes MltA, Family 3 includes MltB, and Family 4 of bacteriophage origin. While most of the LT family members are similar in structure and sequence with a lysozyme-like fold, Family 2 (including mltA) is distinct.
PRK11162	mltA	1.08e-48	162	417	119	346	murein transglycosylase A; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QND73940.1	2.29e-223	16	458	20	481
ABE37658.1	3.35e-220	48	457	14	424
SHK67522.1	4.91e-220	62	458	60	456
QPF87925.1	3.24e-219	32	458	17	448
SHG35497.1	2.17e-218	48	458	19	433

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2PNW_A	3.74e-70	76	427	12	363	Crystalstructure of membrane-bound lytic murein transglycosylase from Agrobacterium tumefaciens [Agrobacterium fabrum str. C58]
6QK4_B	5.91e-64	60	429	12	348	Lytictransglycosylase, LtgG, of Burkholderia pseudomallei. [Burkholderia pseudomallei]
7ESJ_A	3.71e-53	62	430	13	362	ChainA, membrane-bound lytic murein transglycosylase A [Acinetobacter baumannii],7ESJ_B Chain B, membrane-bound lytic murein transglycosylase A [Acinetobacter baumannii]
2G5D_A	1.96e-49	70	435	39	421	Crystalstructure of MltA from Neisseria gonorrhoeae Monoclinic form [Neisseria gonorrhoeae FA 1090]
2G6G_A	4.86e-46	70	435	39	421	Crystalstructure of MltA from Neisseria gonorrhoeae [Neisseria gonorrhoeae FA 1090]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0A935	3.78e-23	162	414	119	342	Membrane-bound lytic murein transglycosylase A OS=Escherichia coli (strain K12) OX=83333 GN=mltA PE=1 SV=1
P0A936	3.78e-23	162	414	119	342	Membrane-bound lytic murein transglycosylase A OS=Escherichia coli O157:H7 OX=83334 GN=mltA PE=3 SV=1
Q9KPQ4	5.32e-23	162	421	114	345	Membrane-bound lytic murein transglycosylase A OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=mltA PE=3 SV=1
P57531	7.65e-21	161	414	118	345	Membrane-bound lytic murein transglycosylase A homolog OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) OX=107806 GN=mltA PE=3 SV=1
Q8K9A7	1.63e-19	161	414	126	353	Membrane-bound lytic murein transglycosylase A homolog OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) OX=198804 GN=mltA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.490644	0.487358	0.007458	0.010536	0.002962	0.001033

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003734_04531.