CAZyme Information: MGYG000003736_01428

Basic Information

• Species: Cupriavidus metallidurans
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Cupriavidus; Cupriavidus metallidurans
• CAZyme ID: MGYG000003736_01428
• CAZy Family: CBM50
• CAZyme Description: 2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
702	MGYG000003736_16|CGC1	74470.72	6.6642

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003736	3680628	MAG	Canada	North America

• Gene Location: Start: 46467; End: 48575 Strand: -

Full Sequence      

MQLHRIQAATLAALLVGVTALAACGSDDTSSSTSGNNGGNSGNSGNGGNNGGNTPAAIVA
GTKSTLALLETTDLHTNVLSYDYFKLAEDKSLGFERVSTLIKSARQEFPNSLLLDNGDTI
QGTALSDYQALVKPVSCTETLAMYKVMNAAGFDGGGIGNHEFNYGLQYLSQVTGSKFNVD
GLPDPTAQTTCAGPKFPQVLANVYSVKTRAPLFQPYAILSKTLTATGPDGKTVTAPIKVG
IIGFAPPAILSWDKRWLDGKVYTEGLVETAQKYIPEMRAKGADLVVVISHGGLDNSTYSP
TMENGSYHLSKVAGVDAMLIGHSHQIFPDANSTVGQFNLPGVDKVKGTVNGVPTVMANYW
GKHLGVINLSLNHDGKSWSVDRTKTTVEARSTQNADKTYVTADASVAPMIDTEHQATIQY
VKTPIGSTNYRMSSYFADVGDPGAIQIVNMAQAAYVKDYVTANLPALASLPVLSVSAPFK
SGFGGGSDYTDVASGNLAINNAADLYLYPNTVYAVKVNGDEVKAWLETAAKRFNQIDPAK
TTDQQLISTFPGYNFDMFTDPDMQYEIDVTQPVGSRIKNLTYKGTPVTAAMNFIVATNNY
RASGGGNFPGLDGTKTIYASPDANRDVLISYIKKVTNVTRVANGSARSWKFTKVTTTGKV
VFSSGIGMLQQATDAGLTNISLDKADDGSGKNLSQYKLDLSL

Enzyme Prediction     

No EC number prediction in MGYG000003736_01428.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09420	cpdB	0.0	56	660	16	606	bifunctional 2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase.
TIGR01390	CycNucDiestase	0.0	66	660	3	583	2',3'-cyclic-nucleotide 2'-phosphodiesterase. 2',3'-cyclic-nucleotide 2'-phosphodiesterase is a bifunctional enzyme localized to the periplasm of Gram-negative bacteria. 2',3'-cyclic-nucleotide 2'-phosphodiesters are intermediates formed during the hydrolysis of RNA by the ribonuclease I, which is also found to the periplasm, and other enzymes of the RNAse T2 family. Bacteria are unable to transport 2',3'-cyclic-nucleotides into the cytoplasm. 2',3'-cyclic-nucleotide 2'-phosphodiesterase contains 2 active sites which catalyze the reactions that convert the 2',3'-cyclic-nucleotide into a 3'-nucleotide, which is then converted into nucleic acid and phosphate. Both final products can be transported into the cytoplasm. Thus, it has been suggested that 2',3'-cyclic-nucleotide 2'-phosphodiesterase has a 'scavenging' function. Experimental evidence indicates that 2',3'-cyclic-nucleotide 2'-phosphodiesterase enables Yersinia enterocolitica O:8 to grow on 2'3'-cAMP as a sole source of carbon and energy (). [Purines, pyrimidines, nucleosides, and nucleotides, Other]
PRK09419	PRK09419	5.29e-178	65	700	41	647	multifunctional 2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase/5'-nucleotidase.
PRK09418	PRK09418	2.03e-166	66	654	40	610	bifunctional 2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase.
PRK11907	PRK11907	5.96e-165	59	652	109	680	bifunctional 2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANF95373.1	6.11e-160	60	701	36	665
AYQ74930.1	5.15e-152	60	664	34	631
APO43595.1	7.17e-150	55	645	25	604
QOS76560.1	4.48e-149	55	645	27	606
QLG37215.1	5.16e-149	55	645	27	606

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EQV_A	9.98e-86	66	421	10	338	1.45Angstrom Crystal Structure of Bifunctional 2',3'-cyclic Nucleotide 2'-phosphodiesterase/3'-Nucleotidase Periplasmic Precursor Protein from Yersinia pestis with Phosphate bound to the Active site [Yersinia pestis CO92]
3JYF_A	1.11e-83	66	421	9	337	ChainA, 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase bifunctional periplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578],3JYF_B Chain B, 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase bifunctional periplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
3GVE_A	2.50e-68	66	422	12	340	Crystalstructure of calcineurin-like phosphoesterase YfkN from Bacillus subtilis [Bacillus subtilis subsp. subtilis str. 168],3GVE_B Crystal structure of calcineurin-like phosphoesterase YfkN from Bacillus subtilis [Bacillus subtilis subsp. subtilis str. 168]
3QFK_A	7.11e-25	64	608	18	485	ChainA, Uncharacterized protein [Staphylococcus aureus subsp. aureus NCTC 8325]
4Q7F_A	7.11e-25	64	608	18	485	ChainA, 5' nucleotidase family protein [Staphylococcus aureus subsp. aureus COL]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26265	4.94e-147	56	632	14	575	2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=cpdB PE=3 SV=2
P08331	6.96e-147	56	632	14	575	2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase OS=Escherichia coli (strain K12) OX=83333 GN=cpdB PE=1 SV=2
P53052	2.82e-144	56	636	12	584	2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase OS=Yersinia enterocolitica OX=630 GN=cpdB PE=3 SV=1
P44764	9.10e-134	66	660	34	614	2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=cpdB PE=3 SV=1
O34313	5.40e-127	66	698	45	651	Trifunctional nucleotide phosphoesterase protein YfkN OS=Bacillus subtilis (strain 168) OX=224308 GN=yfkN PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000010	1.000030	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003736_01428.