CAZyme Information: MGYG000003736_01733

Basic Information

• Species: Cupriavidus metallidurans
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Cupriavidus; Cupriavidus metallidurans
• CAZyme ID: MGYG000003736_01733
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
735	MGYG000003736_22|CGC1	84143.46	6.7153

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003736	3680628	MAG	Canada	North America

• Gene Location: Start: 19047; End: 21254 Strand: +

Full Sequence      

MLSNMNSIDTPDFSVDVIIAVRSRDEYDVIERLRWRTTYRLPGNIRFLVVDYGSSPEESA
KISEVCRNGGFTYIYVDARGEIWNASEARNAAILESTAEYLLFEDVDLVNHVDFYNWLNI
QIKSLIIKGGWPFIVAPVSYLTQEAAESFSGAAFDDETYADLTTEINDPDSTVIEFHAPV
SSYMLCRRQDVISIGGHDPAFEGWGLEDSDFALKLLRATETQKPREFYRLDTRKYSDQVQ
WRGWRALFRVYGDLLANKGIYSFHIWHPIASHRSVAVRERNLKIFKHNSQLYGDQKFTPT
PLWNSKKPTHLFLGKNPHSFNTAVFEVFNNPLLIEEHDIEPRNVGELIEKYSIESIIFNN
PYATPRRQAIYEKCKELGVATYVVERGALPWSIYIDRHGFCAESTAYQESNWPVELSDER
RANTIDYISSLKIEGVALEPQSNMIGGKNLKRTLFGESIETKILFVAMQSPSDTTTNFFC
GQIKTYQDFVNEVRLLPEFLGPEWRVVYKNHPLTLDKEKFAGAVNVDDYHIGDILEMADA
VTLINSGVGVLSAAYGKPVFYFGEAFYACDGLNAHVASAMDLAGKISEFKTVDSEKMIRF
FSYLIHDFYSFAKWERKERKHTDKAKLSISENIKYEVVRVPGRAESIVRSRKIVDLQRSM
LFDRYRLDEYMSRQAPVSRSAVNAASEKSAVPIVVARTEIRPKTQGSAFGRKWRKLVRDP
KLFIADALLKRRASQ

Enzyme Prediction     

No EC number prediction in MGYG000003736_01733.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	17	268	4.5e-25	0.9057971014492754

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam10111	Glyco_tranf_2_2	2.24e-18	17	267	2	251	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
cd16438	beta_Kdo_transferase_KpsS_like	3.41e-18	365	608	9	247	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsS like. KpsS is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides that are important virulence factors for many pathogenic bacteria.
COG4092	COG4092	6.21e-11	98	267	95	267	Predicted glycosyltransferase involved in capsule biosynthesis [Cell wall/membrane/envelope biogenesis].
cd06420	GT2_Chondriotin_Pol_N	1.85e-08	85	218	67	165	N-terminal domain of Chondroitin polymerase functions as a GalNAc transferase. Chondroitin polymerase is a two domain, bi-functional protein. The N-terminal domain functions as a GalNAc transferase. The bacterial chondroitin polymerase catalyzes elongation of the chondroitin chain by alternatively transferring the GlcUA and GalNAc moiety from UDP-GlcUA and UDP-GalNAc to the non-reducing ends of the chondroitin chain. The enzyme consists of N-terminal and C-terminal domains in which the two active sites catalyze the addition of GalNAc and GlcUA, respectively. Chondroitin chains range from 40 to over 100 repeating units of the disaccharide. Sulfated chondroitins are involved in the regulation of various biological functions such as central nervous system development, wound repair, infection, growth factor signaling, and morphogenesis, in addition to its conventional structural roles. In Caenorhabditis elegans, chondroitin is an essential factor for the worm to undergo cytokinesis and cell division. Chondroitin is synthesized as proteoglycans, sulfated and secreted to the cell surface or extracellular matrix.
cd16441	beta_Kdo_transferase_KpsS	1.11e-05	526	609	222	307	beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase KpsS. KpsS is a beta-3-deoxy-D-manno-oct-2-ulosonic acid (Kdo)-transferase. It is part of the ATP-binding cassette transporter dependent capsular polysaccharides (CPSs) synthesis pathway, one of two CPS synthesis pathways present in Escherichia coli. The poly-Kdo linker is thought to be the common feature of CPSs synthesized via this pathway. CPSs are high-molecular-mass cell-surface polysaccharides that are important virulence factors for many pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMT36188.1	5.38e-302	1	731	2	752
ABR63783.1	2.63e-129	17	690	21	691
ASP99736.1	4.67e-125	17	694	6	682
AIF80905.1	2.99e-114	12	727	15	722
CAQ71699.1	6.25e-112	17	727	10	744

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003736_01733.