CAZyme Information: MGYG000003739_01301

Basic Information

• Species: Streptococcus oralis_E
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus oralis_E
• CAZyme ID: MGYG000003739_01301
• CAZy Family: GT1
• CAZyme Description: 4'-demethylrebeccamycin synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
422		47841.8	5.1832

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003739	1855725	MAG	Canada	North America

• Gene Location: Start: 14052; End: 15320 Strand: -

Full Sequence      

MRKIKIDVVVVPLSGHLFPTLNLLAPLLKDPLYEIRLFTGPQRKTVAEEMGFRVIPILEN
CVDEFERVANNEGQLNLFSAYRQLSASLDLINVVSDQLVQEWQENRPDIVITDFITLSGG
LVAEQLNIPWITTMATQFAIETTDGPPCFFGGMGSPKTSFQSGLQWTGRKGIRLGKRIVS
FLLRERLKRYDFKLYNQKGQETIYSPYSILGIGMKELELNSGFPEHYLWVGPFGSSIERA
ENYPLNLSPYAGYKKVLVSCGTQLAWAKDNLLYQTQQLAEAHPDCHFFVTLGFGGQDFQC
EELMDNVSVVSYLPYKEYIPQMDYVIHHGGAGIFYQCIIYGKPALILPHDYDQYDYAVRG
LEAGIALTAKREDTEAIGRAFDELLARDDWADLNKLSRAAQIYQPTEILKSEIHRLLGDK
EK

Enzyme Prediction     

No EC number prediction in MGYG000003739_01301.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	20	415	1.1e-17	0.9659685863874345

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1819	YjiC	1.59e-28	5	422	3	404	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
cd03784	GT1_Gtf-like	4.27e-26	5	385	2	373	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
pfam04101	Glyco_tran_28_C	2.13e-04	256	361	2	106	Glycosyltransferase family 28 C-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). Structural analysis suggests the C-terminal domain contains the UDP-GlcNAc binding site.
cd03785	GT28_MurG	0.005	15	129	11	114	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANR76225.1	3.12e-311	1	422	1	422
ATF57445.1	3.12e-311	1	422	1	422
QRO08088.1	8.95e-311	1	422	1	422
QQL00321.1	8.95e-311	1	422	1	422
QLL97959.1	8.95e-311	1	422	1	422

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6KQW_A	3.17e-13	1	373	1	338	ChainA, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168]
6KQX_A	3.24e-13	1	373	1	338	ChainA, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168],7BOV_A Chain A, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168]
6J31_A	5.59e-08	6	366	7	340	CrystalStructure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_B Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_C Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_D Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora]
6J32_A	5.64e-08	6	366	10	343	CrystalStructure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J32_B Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J32_C Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J32_D Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora]
7LVY_A	2.62e-07	302	389	339	421	ChainA, UDP-glycosyltransferase 203A2 [Tetranychus urticae],7MCO_A Chain A, UDP-glycosyltransferase 203A2 [Tetranychus urticae],7MCO_B Chain B, UDP-glycosyltransferase 203A2 [Tetranychus urticae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34539	1.78e-12	1	373	1	338	NDP-glycosyltransferase YjiC OS=Bacillus subtilis (strain 168) OX=224308 GN=yjiC PE=1 SV=1
Q8KHE4	1.90e-08	5	385	4	388	4'-demethylrebeccamycin synthase OS=Lentzea aerocolonigenes OX=68170 GN=rebG PE=1 SV=1
Q9R110	3.86e-07	7	355	52	402	UDP-glucuronosyltransferase 2A3 OS=Cavia porcellus OX=10141 GN=UGT2A3 PE=2 SV=1
Q65JC2	2.23e-06	11	376	11	346	NDP-glycosyltransferase YjiC OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46) OX=279010 GN=yjiC PE=1 SV=1
P17717	4.83e-06	56	385	111	434	UDP-glucuronosyltransferase 2B17 OS=Mus musculus OX=10090 GN=Ugt2b17 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003739_01301.