CAZyme Information: MGYG000003739_01692

Basic Information

• Species: Streptococcus oralis_E
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus oralis_E
• CAZyme ID: MGYG000003739_01692
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
339	MGYG000003739_70|CGC1	39220.52	4.3968

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003739	1855725	MAG	Canada	North America

• Gene Location: Start: 4651; End: 5670 Strand: +

Full Sequence      

MKKNDLFIDVSSHNGYDITGILADMGTQNTIIKVSESTNYLNPCRHAQVEQSNPIGFYHF
AWFGGDVDEAEREARYFLENVPVSVPYLVLDYEDHASNDVQANTDACIKFMQILADDGYK
PIYYSYKPFTLANVDYQQILAKFPDSLWIAGYGLNDGTANFEYFPSMDGISWWQYSSNPF
DQNIVLLDDEPEQEARTAGTWKKDSNGWWFRRDNGSFPYNKWEKIAGVWYYFNERGYSIA
SRWLKDDGKWYYLKENGAMATGWVFVNGKWYYLNASGEMVTGWVQYKDKLYHLKEENGEM
SSEELVKVEGGWYYINEDGSRSDKPAFNVLPDGLIVTTK

Enzyme Prediction     

EC	3.2.1.17

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	8	178	1.7e-34	0.96045197740113

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06415	GH25_Cpl1-like	9.18e-74	5	187	1	196	Cpl-1 lysin (also known as Cpl-9 lysozyme / muramidase) is a bacterial cell wall endolysin encoded by the pneumococcal bacteriophage Cp-1, which cleaves the glycosidic N-acetylmuramoyl-(beta1,4)-N-acetylglucosamine bonds of the pneumococcal glycan chain, thus acting as an enzymatic antimicrobial agent (an enzybiotic) against streptococcal infections. Cpl-1 belongs to the CP family of lysozymes (CPL lysozymes) which includes the Cpl-7 lysin. Cpl-1 has a glycosyl hydrolase family 25 (GH25) catalytic domain with an irregular (beta/alpha)5-beta3 barrel and a C-terminal cell wall-anchoring module formed by six similar choline-binding repeats (ChBr's). The ChBr's facilitate the anchoring of Cpl-1 to the choline-containing teichoic acid of the pneumococcal cell wall. Other members of this domain family have an N-terminal CHAP (cysteine, histidine-dependent amidohydrolases/peptidases) domain similar to that of the firmicute CHAP lysins and associated with endopeptidase activity. The Cpl-7 lysin is also included here as is LysB of Lactococcus phage, and the Mur lysin of Lactobacillus phage.
pfam01183	Glyco_hydro_25	9.73e-37	8	179	1	175	Glycosyl hydrolases family 25.
NF033840	PspC_relate_1	1.49e-34	190	319	501	627	PspC-related protein choline-binding protein 1. Members of this family share C-terminal homology to the choline-binding form of the pneumococcal surface antigen PspC, but not to its allelic LPXTG-anchored forms because they lack the choline-binding repeat region. Members of this family should not be confused with PspC itself, whose identity and function reflect regions N-terminal to the choline-binding region. See Iannelli, et al. (PMID: 11891047) for information about the different allelic forms of PspC.
NF033930	pneumo_PspA	1.75e-34	191	320	434	580	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.
NF033930	pneumo_PspA	2.36e-33	198	336	522	653	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBX17232.1	1.52e-148	1	339	1	334
CDQ30262.1	4.35e-148	1	339	1	334
APD22503.1	7.15e-147	1	339	1	334
APD22603.1	1.97e-146	1	337	1	332
APD22024.1	4.11e-146	1	339	1	334

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1H09_A	2.06e-141	1	335	1	335	ChainA, LYSOZYME [Streptococcus phage Cp1]
2IXU_A	2.14e-141	1	335	2	336	ChainA, LYSOZYME [Streptococcus phage Cp1]
2IXV_A	6.10e-141	1	335	2	336	ChainA, LYSOZYME [Streptococcus phage Cp1],2J8F_A Chain A, LYSOZYME [Streptococcus phage Cp1],2J8G_A Chain A, LYSOZYME [Streptococcus phage Cp1]
1OBA_A	4.97e-140	1	335	2	336	ChainA, Lysozyme [Streptococcus phage Cp1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P15057	1.17e-140	1	335	2	336	Lysozyme OS=Streptococcus phage Cp-1 OX=10747 GN=CPL1 PE=1 SV=2
P19386	3.64e-137	1	335	2	336	Lysozyme OS=Streptococcus phage Cp-9 OX=10749 GN=CPL9 PE=3 SV=1
P19385	3.22e-114	1	202	2	203	Lysozyme OS=Streptococcus phage Cp-7 OX=10748 GN=CPL7 PE=1 SV=2
Q8HA43	1.57e-60	1	190	150	346	D-alanyl-L-alanine endopeptidase OS=Streptococcus phage B30 OX=209152 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003739_01692.