CAZyme Information: MGYG000003742_00681

Basic Information

• Species: Prevotella buccalis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella buccalis
• CAZyme ID: MGYG000003742_00681
• CAZy Family: GH30
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
512	MGYG000003742_14|CGC1	57117.37	5.4687

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003742	2540681	MAG	Canada	North America

• Gene Location: Start: 15107; End: 16645 Strand: +

Full Sequence      

MYITSLLLSASLFLSIACSVDSGLNIQPEVKPENPTPSPVPQANKVKTFTTTSDGFMQLA
QKEISLKAGESLAPSTILIDDTKVGQEIDGFGFAITYSTCYNLLHMSAADRADFLKRTYS
ETEGYGVSYARISIGCNDFSSTEYTLCDEKGLEHFRLYKDETDYVIPILKEILAINPKLK
IVAAPWTCPKWMKVKDLKTKAPFDSWTDGHVNPDHYTDYANYFVKFVQTMKAEGINIYSV
SPQNEPLNRANCASTYMPWQEQAEFVKELAKAFKKNALKTKIYLFDHNYNYDNKADQEDY
PVKIYNALGNEFEGSEYVVGAAYHDYGGSNTELDDIYAKAPDKELIFSESSIGTWNNGRN
LSARLLPDMKNVILGTVNRHCKAVLVWNLMLDEKMGPNLDGGCQTCYGAVDIASDYKTLH
RNSHYYIISHISSVVRPGAVRIEDSSRSAHIKDVDYATFRNPDSTYGIVLANSGGHDQMI
TVSNGAYNFQVTVPAEGVVSCIWNPSVTSKKD

Enzyme Prediction     

EC	3.2.1.75

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH30	75	503	2.6e-136	0.988009592326139

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5520	XynC	2.30e-43	86	504	45	429	O-Glycosyl hydrolase [Cell wall/membrane/envelope biogenesis].
pfam02055	Glyco_hydro_30	1.46e-32	88	432	1	345	Glycosyl hydrolase family 30 TIM-barrel domain.
pfam17189	Glyco_hydro_30C	4.18e-08	438	501	1	63	Glycosyl hydrolase family 30 beta sandwich domain.
pfam02057	Glyco_hydro_59	0.001	168	365	79	236	Glycosyl hydrolase family 59.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS85385.1	1.33e-241	44	503	20	479
QNT65067.1	1.92e-240	6	504	10	514
AHW59378.1	4.19e-187	16	503	21	497
ALJ44501.1	3.92e-186	39	506	30	492
QUT73412.1	3.92e-186	39	506	30	492

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NGK_A	5.98e-187	39	506	31	493	Theendo-beta1,6-glucanase BT3312 [Bacteroides thetaiotaomicron],5NGK_B The endo-beta1,6-glucanase BT3312 [Bacteroides thetaiotaomicron],5NGK_C The endo-beta1,6-glucanase BT3312 [Bacteroides thetaiotaomicron],5NGL_A The endo-beta1,6-glucanase BT3312 [Bacteroides thetaiotaomicron],5NGL_B The endo-beta1,6-glucanase BT3312 [Bacteroides thetaiotaomicron],5NGL_C The endo-beta1,6-glucanase BT3312 [Bacteroides thetaiotaomicron]
2WNW_A	9.29e-37	52	503	7	442	Thecrystal structure of SrfJ from salmonella typhimurium [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],2WNW_B The crystal structure of SrfJ from salmonella typhimurium [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
4FMV_A	7.48e-07	76	506	6	356	CrystalStructure Analysis of a GH30 Endoxylanase from Clostridium papyrosolvens C71 [Ruminiclostridium papyrosolvens DSM 2782]
4UQA_A	7.29e-06	181	473	99	354	ChainA, Carbohydrate Binding Family 6 [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8J0I9	1.16e-37	37	502	23	486	Endo-1,6-beta-D-glucanase BGN16.3 OS=Trichoderma harzianum OX=5544 PE=1 SV=1
O16580	2.25e-36	51	474	61	483	Putative glucosylceramidase 1 OS=Caenorhabditis elegans OX=6239 GN=gba-1 PE=1 SV=2
Q9UB00	1.40e-35	43	472	56	483	Putative glucosylceramidase 4 OS=Caenorhabditis elegans OX=6239 GN=gba-4 PE=3 SV=2
Q4WBR2	1.76e-35	42	502	22	484	Endo-1,6-beta-D-glucanase neg1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=neg1 PE=1 SV=1
O16581	5.00e-33	43	472	54	479	Putative glucosylceramidase 2 OS=Caenorhabditis elegans OX=6239 GN=gba-2 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000139	0.999903	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003742_00681.