CAZyme Information: MGYG000003744_00533

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9
• CAZyme ID: MGYG000003744_00533
• CAZy Family: CE1
• CAZyme Description: Endo-1,4-beta-xylanase Z

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
286		32806.68	7.058

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003744	2038806	MAG	Canada	North America

• Gene Location: Start: 6198; End: 7058 Strand: +

Full Sequence      

MNMKKLIPFFLLLLMPVLAVHAGRVVTDSLRSNILGKTVKFNVYLPDGFDRSEKKYPVVY
LLHGLSDTYTAWEERGRMKLVADELIASGEAKEMVIVMPNAGHPDIHHEWNGYFNMPGWN
YEDFFFREFLPAVEAKYRCIGDKEHRAVMGLSMGGGGSTVYCQRHPDLFSSCYAMSAWLD
NEAGQVGGKEQKKDKLYLVSESVKAHSALAFLDNADEETLGKLRTVKWFFDCGDDDFLLE
LSTRLHLKMRQAKVKSELRVRNGVHNWEYWHLALREALPFASRNFE

Enzyme Prediction     

No EC number prediction in MGYG000003744_00533.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	32	282	1.6e-57	0.9823788546255506

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00756	Esterase	3.22e-24	32	280	1	245	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG0627	FrmB	1.91e-17	14	286	9	313	S-formylglutathione hydrolase FrmB [Defense mechanisms].
COG2382	Fes	4.65e-17	22	278	65	292	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
COG2819	YbbA	2.49e-04	30	183	14	178	Predicted hydrolase of the alpha/beta superfamily [General function prediction only].
COG4947	COG4947	7.77e-04	164	271	121	220	Esterase/lipase superfamily enzyme [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEH32729.1	2.81e-31	23	279	147	392
QEH34939.1	2.05e-28	31	279	157	397
AYN68397.1	6.59e-28	32	279	148	387
CBK90399.1	6.74e-27	23	274	133	359
QIP13464.1	8.22e-27	19	283	139	385

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5VOL_A	4.00e-93	23	285	10	272	Bacint_04212ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_B Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_C Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_D Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_E Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_F Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_G Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393],5VOL_H Bacint_04212 ferulic acid esterase [Bacteroides intestinalis DSM 17393]
6RZN_A	1.54e-27	23	279	130	382	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium],6RZN_B Crystal structure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
1JJF_A	1.58e-21	20	282	27	258	ChainA, Endo-1,4-beta-xylanase Z [Acetivibrio thermocellus]
1JT2_A	4.19e-21	20	282	27	258	ChainA, PROTEIN (ENDO-1,4-BETA-XYLANASE Z) [Acetivibrio thermocellus]
7B5V_A	1.98e-18	43	155	157	275	ChainA, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B5V_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_A Chain A, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P10478	1.02e-19	20	282	46	277	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
D5EXZ4	9.42e-17	43	279	449	666	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
D5EY13	7.88e-16	20	169	495	646	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1
P9WM38	1.12e-11	31	176	180	318	Esterase MT1326 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT1326 PE=3 SV=1
P9WM39	1.12e-11	31	176	180	318	Esterase Rv1288 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1288 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000237	0.999150	0.000160	0.000144	0.000145	0.000136

TMHMM  Annotations     

start	end
7	26