CAZyme Information: MGYG000003744_01203

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9
• CAZyme ID: MGYG000003744_01203
• CAZy Family: CBM32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
528		57826.32	5.2171

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003744	2038806	MAG	Canada	North America

• Gene Location: Start: 679; End: 2265 Strand: +

Full Sequence      

MPLLCLAALAIGCGEKETPAPQPVGDLKAYPGRNAAKVEFSVASDVRSGKIFYASGSFDE
FTVSDPGAVQSVVVRGLPEGENIIRVVTMNADSVYSDPRGVKVLVYGDSYLKKLSNRVLK
DQKFISASSIELMFGEALADETELRVFFTTTSGVQDSVLLSTGQTTIKLNDIDLGKDYRY
CSVFKPTADFIDEYVTEKVSIPDLNKKKFWKNIWRIKAVSSEDSQMKAANLIDNQVNSVW
RSQGVSGPHWIVVDMQGPKLYDGFIVVQAQELKNGGGFSRRYVFESSDDGSAWNMVQDGR
LRAHGYRQKIVFKHSVTSRYFRITVQDSYDDAIPQLAELDLFNDTGTSGQNGLNIPMLVN
AKPPFQGDGSDRFPAVGAGRMQRLTGWTHNAAANISYDKATGFFSIFSAAVWGCPSVTNG
KIYQSLDLLPGKYVLKVDVGNTTNPACTDAFGIITKADTLPDFQNVETDRDVVGSADLDA
HAQSMVTIPFALGSPSKVAIGIVYNTYNIYPTTIWSDLSFKSFVVESE

Enzyme Prediction     

No EC number prediction in MGYG000003744_01203.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM32	220	327	9e-17	0.7903225806451613

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00754	F5_F8_type_C	1.26e-18	216	339	2	127	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
pfam16389	DUF4998	9.12e-18	26	194	25	199	Domain of unknown function. This family around 200 residues locates in the N-terminal of some uncharacterized proteins in various Bacteroides and Parabacteroides species. The function of this family remains unknown.
pfam16405	DUF5013	2.19e-12	360	501	2	145	Domain of unknown function (DUF5013). This small family of proteins is functionally uncharacterized. This family is found in various Bacteroides and Parabacteroides species. Proteins in this family are around 400 amino acids in length.
cd00057	FA58C	5.41e-10	214	326	12	129	Substituted updates: Jan 31, 2002
cd08666	APC10-HECTD3	0.002	218	256	11	49	APC10-like DOC1 domain of HECTD3, a HECT E3 ubiquitin ligase protein that mediates substrate ubiquitination. This model represents the APC10/DOC1 domain present in HECTD3, a HECT (Homologous to the E6-AP Carboxyl Terminus) E3 ubiquitin ligase protein. HECT E3 ubiquitin ligases mediate substrate ubiquitination (or ubiquitylation), and are a component of the ubiquitin-26S proteasome pathway for selective proteolytic degradation. They also regulate the trafficking of many receptors, channels, transporters and viral proteins. HECTD3 (HECT domain-containing protein3) contains a C-terminal HECT domain with the active site for ubiquitin transfer onto substrates, and an N-terminal APC10/DOC1 domain, which is responsible for substrate recognition and binding. HECTD3 specifically recognizes the Trio-binding protein, Tara (Trio-associated repeat on actin), implicated in regulating actin cytoskeletal, cell motility and cell growth. Tara also binds to TRF1 and may participate in telomere maintenance and/or mitotic regulation through interacting with TRF1. HECTD3 interacts with and promotes the ubiquitination of Syntaxin 8, an endosomal syntaxin proposed to mediate distinct steps of endosomal protein trafficking. HECTD3-mediated Syntaxin 8 degradation has been suggested to contribute to the pathophysiology of neurodegenerative diseases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEH16335.1	1.16e-146	6	528	13	539
QMW86484.1	3.38e-11	26	339	44	385
BCA48665.1	1.89e-10	26	339	44	385
AIE86518.1	5.89e-10	214	340	1111	1240
QUT41988.1	9.96e-10	26	339	33	374

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000039	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003744_01203.