CAZyme Information: MGYG000003744_01426

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9
• CAZyme ID: MGYG000003744_01426
• CAZy Family: CE19
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
334		36903.9	10.0819

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003744	2038806	MAG	Canada	North America

• Gene Location: Start: 2404; End: 3408 Strand: -

Full Sequence      

MKRIVARGSVLRRFERVAGRLPRNVRTRFAVEYADSLRRERHVRYSVSFEVAPSERVHAY
LYRPLTGPGPFPAVVALHSTGAGGKRIIDGETAIADRQYARELADRGYVVIAPDYPGFGE
ASDDDFSSDRYASGTMRGIFNHISCVSLLQSLPYVDGSRIGAIGHSLGGHNAIFLAAFDR
RIKAVVSSCGWTVLKEYDAGPEVTASYGGKLGPWAQPRYMPRFRDVYGLDPARIPFDFDA
LIASLAPRAFLSISPLHDTNFSVDGVRKGSQRIAARYRRCHASDRFVVVYPDCGHDFPLA
NRHLAYQFLDRFLTPAPNSVPAPGKGQGGVVRSR

Enzyme Prediction     

No EC number prediction in MGYG000003744_01426.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE19	23	187	2e-19	0.48493975903614456

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0412	DLH	3.53e-18	52	187	9	141	Dienelactone hydrolase [Secondary metabolites biosynthesis, transport and catabolism].
COG1506	DAP2	1.17e-12	23	315	348	616	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].
COG3458	Axe1	5.42e-10	45	186	57	204	Cephalosporin-C deacetylase or related acetyl esterase [Secondary metabolites biosynthesis, transport and catabolism].
pfam01738	DLH	1.28e-09	59	210	2	152	Dienelactone hydrolase family.
pfam05448	AXE1	8.46e-09	45	186	56	202	Acetyl xylan esterase (AXE1). This family consists of several bacterial acetyl xylan esterase proteins. Acetyl xylan esterases are enzymes that hydrolyze the ester linkages of the acetyl groups in position 2 and/or 3 of the xylose moieties of natural acetylated xylan from hardwood. These enzymes are one of the accessory enzymes which are part of the xylanolytic system, together with xylanases, beta-xylosidases, alpha-arabinofuranosidases and methylglucuronidases; these are all required for the complete hydrolysis of xylan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBD44994.1	8.34e-122	7	313	494	800
ACU02566.1	3.35e-108	5	313	59	370
QIJ55688.1	6.21e-105	7	321	47	364
AHF14518.1	2.60e-103	7	310	52	358
QEH40625.1	2.61e-102	5	313	49	358

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2JBW_A	4.42e-07	67	204	148	269	CrystalStructure of the 2,6-dihydroxy-pseudo-oxynicotine Hydrolase. [Paenarthrobacter nicotinovorans],2JBW_B Crystal Structure of the 2,6-dihydroxy-pseudo-oxynicotine Hydrolase. [Paenarthrobacter nicotinovorans],2JBW_C Crystal Structure of the 2,6-dihydroxy-pseudo-oxynicotine Hydrolase. [Paenarthrobacter nicotinovorans],2JBW_D Crystal Structure of the 2,6-dihydroxy-pseudo-oxynicotine Hydrolase. [Paenarthrobacter nicotinovorans]
5XB6_A	6.27e-06	99	219	54	181	Crystalstructure of YcjY from E. Coli [Escherichia coli K-12],5XB6_B Crystal structure of YcjY from E. Coli [Escherichia coli K-12],5XB6_C Crystal structure of YcjY from E. Coli [Escherichia coli K-12],5XB6_D Crystal structure of YcjY from E. Coli [Escherichia coli K-12],5XB6_E Crystal structure of YcjY from E. Coli [Escherichia coli K-12],5XB6_F Crystal structure of YcjY from E. Coli [Escherichia coli K-12],5XB6_G Crystal structure of YcjY from E. Coli [Escherichia coli K-12],5XB6_H Crystal structure of YcjY from E. Coli [Escherichia coli K-12],5XB6_I Crystal structure of YcjY from E. Coli [Escherichia coli K-12],5XB6_J Crystal structure of YcjY from E. Coli [Escherichia coli K-12],5XB6_K Crystal structure of YcjY from E. Coli [Escherichia coli K-12],5XB6_L Crystal structure of YcjY from E. Coli [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34973	7.02e-22	16	313	11	299	Putative hydrolase YtaP OS=Bacillus subtilis (strain 168) OX=224308 GN=ytaP PE=3 SV=1
B2RIT0	6.14e-11	101	190	478	567	Dipeptidyl-peptidase 5 OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561) OX=431947 GN=dpp5 PE=1 SV=1
Q9QYR7	6.30e-07	56	304	154	385	Acyl-coenzyme A thioesterase 3 OS=Mus musculus OX=10090 GN=Acot3 PE=1 SV=1
Q93NG6	2.32e-06	67	204	134	255	2,6-dihydropseudooxynicotine hydrolase OS=Paenarthrobacter nicotinovorans OX=29320 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003744_01426.