CAZyme Information: MGYG000003744_01502

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA932; RC9
• CAZyme ID: MGYG000003744_01502
• CAZy Family: GH95
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
379		41985.55	6.1397

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003744	2038806	MAG	Canada	North America

• Gene Location: Start: 1953; End: 3092 Strand: -

Full Sequence      

MNHWMAETGNLSELVEPLVKFTKSLVPSGERSAKAFYGPEAKGWVQHMMTNVWHYTDPGE
DPSWGATCTGGAWLCQHLYDHYRFRPDTACLREIYPVLKGAAAFFLSTMVEEPVHGWIVT
SPSSSPENAFYTSAGAHANVCMGPTMDVEIITELYQNVMAAARTLGVDAAFADSLASALA
KFPPLQISPEGCLQEWLEDYRETDVHHRHVSHLFGLYPGNLISVSGTPELAEACRKTLER
RGDGGTGWSRAWKINFWARLQDGDHALLLLKNLLEPAFSKQDVNYRSGGTYANLFCAHPP
FQIDGNLGGAAGIQEMLLQPQEGGFLLLPALPAEWPDGEFRGFRLPGGDTVDLAWKNGRP
FRLKINGVRTEISNQHIKR

Enzyme Prediction     

EC	3.2.1.63

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH95	1	369	7.5e-150	0.48476454293628807

CDD Domains     

MGYG000003744_01502 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT37088.1	2.21e-166	1	368	405	773
BBK86689.1	2.21e-166	1	368	405	773
QUU01450.1	1.77e-165	1	368	405	773
QUT65992.1	3.53e-165	1	368	405	773
QQA29799.1	3.53e-165	1	368	405	773

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2RDY_A	3.09e-103	2	371	378	748	ChainA, BH0842 protein [Halalkalibacterium halodurans C-125],2RDY_B Chain B, BH0842 protein [Halalkalibacterium halodurans C-125]
7KMQ_A	3.23e-102	1	369	398	751	ChainA, Glyco_hyd_65N_2 domain-containing protein [Xanthomonas citri pv. citri str. 306],7KMQ_B Chain B, Glyco_hyd_65N_2 domain-containing protein [Xanthomonas citri pv. citri str. 306]
4UFC_A	2.47e-99	1	357	377	723	Crystalstructure of the GH95 enzyme BACOVA_03438 [Bacteroides ovatus],4UFC_B Crystal structure of the GH95 enzyme BACOVA_03438 [Bacteroides ovatus]
2EAB_A	3.46e-45	1	365	427	839	Crystalstructure of 1,2-a-L-fucosidase from Bifidobacterium bifidum (apo form) [Bifidobacterium bifidum],2EAB_B Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum (apo form) [Bifidobacterium bifidum],2EAC_A Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum in complex with deoxyfuconojirimycin [Bifidobacterium bifidum],2EAC_B Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum in complex with deoxyfuconojirimycin [Bifidobacterium bifidum]
2EAD_A	6.40e-45	1	365	427	839	ChainA, Alpha-fucosidase [Bifidobacterium bifidum],2EAD_B Chain B, Alpha-fucosidase [Bifidobacterium bifidum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8L7W8	6.76e-93	1	358	438	795	Alpha-L-fucosidase 2 OS=Arabidopsis thaliana OX=3702 GN=FUC95A PE=1 SV=1
A2R797	1.98e-48	1	357	394	758	Probable alpha-fucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=afcA PE=3 SV=1
Q5AU81	6.94e-47	1	355	414	775	Alpha-fucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=afcA PE=1 SV=1
Q2USL3	2.70e-19	1	372	391	712	Probable alpha-fucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=afcA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003744_01502.