CAZyme Information: MGYG000003745_00656

Basic Information

• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Eggerthellaceae; CAG-1427
• CAZyme ID: MGYG000003745_00656
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
261		29977.22	7.6611

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003745	1293229	MAG	Canada	North America

• Gene Location: Start: 2153; End: 2938 Strand: +

Full Sequence      

MAQLQIPKKIHYIWFGEGCLTQLAEQCLASWQTFCPDYEIIRWDESNFDDGGNRYFKEAI
QARKWAFASDYARLKVLFEHGGIYMDTDVEVLKPLDRFLFEEAFSGFESTSCVPTGLMAS
RAGNQFLKRLLSDYDNRRFIKEDGTFDLTTNVTLITEACVSAGLKLNGKKQTVAGFTLYP
QDFFCPKAHDTGIVHLSENSYAIHHFDGSWLPPEFSLYQSEKKNLVKRHPHLPVRLVKGI
ALGKACLRDNSLKPFRAWRDR

Enzyme Prediction     

No EC number prediction in MGYG000003745_00656.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	24	99	2.1e-21	0.9333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	3.97e-18	6	128	82	208	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	2.65e-17	30	104	10	92	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
pfam05704	Caps_synth	5.80e-09	5	134	45	191	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.
pfam12919	TcdA_TcdB	3.83e-04	53	122	158	221	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT95860.1	2.26e-81	6	261	2	257
AST53065.1	3.68e-80	6	261	2	257
BBK91625.1	2.71e-79	6	226	2	222
QJE27088.1	7.57e-78	6	211	2	207
QYR65866.1	4.99e-77	6	212	2	208

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5ZU30	3.88e-06	3	149	25	200	Subversion of eukaryotic traffic protein A OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) OX=272624 GN=setA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000036	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003745_00656.