CAZyme Information: MGYG000003750_00381

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Tissierellales; Peptoniphilaceae; Murdochiella
• CAZyme ID: MGYG000003750_00381
• CAZy Family: GT4
• CAZyme Description: Alpha-galactosylglucosyldiacylglycerol synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
349		39646.17	5.709

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003750	1336631	MAG	Canada	North America

• Gene Location: Start: 10911; End: 11960 Strand: -

Full Sequence      

MLTINMVTPGNNVAGQGVGSATNELIHLLETHAHDALRIQRNTAKNADITHVHTIHPFSY
AQMIASKTPVVMHVHFLPDTLEGSIQIAPPFDKLFGGYVMKMYRSADELVVVNPYFIDAL
QAYDLPQESITYMPNVVDSSAFRPARGEHPLIYDRYRIDPEAFNVIAVGQVQTRKGVADF
IDVAERCPQLQFYWAGGFSFGAITDGYKDLKERMENPPENVHFLDIVPRNEMNALYNAMN
VLFMPSYAELFPMAVMEAVHSGLPIVLRDLDLYRVIYFTDYLRAKDNAGFADLLLRLSTD
SAFYTQAKCSSVKIAEDYSEDSIAEKWIHYYHRIFEKYDGKRGKTFFES

Enzyme Prediction     

No EC number prediction in MGYG000003750_00381.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	159	301	1.6e-17	0.9125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03801	GT4_PimA-like	2.38e-29	41	332	77	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	1.14e-25	32	337	69	380	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03798	GT4_WlbH-like	1.47e-19	103	266	148	304	Bordetella parapertussis WlbH and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. Staphylococcus aureus CapJ may be involved in capsule polysaccharide biosynthesis. WlbH in Bordetella parapertussis has been shown to be required for the biosynthesis of a trisaccharide that, when attached to the B. pertussis lipopolysaccharide (LPS) core (band B), generates band A LPS.
cd03807	GT4_WbnK-like	2.70e-18	46	332	79	362	Shigella dysenteriae WbnK and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. WbnK in Shigella dysenteriae has been shown to be involved in the type 7 O-antigen biosynthesis.
cd03809	GT4_MtfB-like	3.08e-18	34	329	72	362	glycosyltransferases MtfB, WbpX, and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. MtfB (mannosyltransferase B) in E. coli has been shown to direct the growth of the O9-specific polysaccharide chain. It transfers two mannoses into the position 3 of the previously synthesized polysaccharide.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCT45448.1	1.48e-105	2	337	5	341
QSI25395.1	5.08e-105	2	344	7	350
QIX09933.1	2.54e-104	2	343	7	350
QQR25823.1	2.54e-104	2	343	7	350
ASU17271.1	2.54e-104	2	343	7	350

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8DPV9	6.25e-76	2	333	33	367	Alpha-galactosylglucosyldiacylglycerol synthase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=cpoA PE=1 SV=1
Q8KQL6	2.50e-20	48	325	45	318	Processive diacylglycerol alpha-glucosyltransferase OS=Acholeplasma laidlawii OX=2148 GN=dgs PE=1 SV=1
A7TZT2	1.73e-07	29	267	126	363	Mannosylfructose-phosphate synthase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=mfpsA PE=1 SV=1
Q8FSH1	2.87e-06	11	266	67	333	D-inositol 3-phosphate glycosyltransferase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) OX=196164 GN=mshA PE=3 SV=1
Q6NJL3	5.10e-06	101	326	163	400	D-inositol 3-phosphate glycosyltransferase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) OX=257309 GN=mshA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003750_00381.