CAZyme Information: MGYG000003752_01693

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; CAG-180
• CAZyme ID: MGYG000003752_01693
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
811		89288.34	4.9145

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003752	1933650	MAG	Canada	North America

• Gene Location: Start: 15405; End: 17840 Strand: -

Full Sequence      

MSLISKIVSKFSGLSQEETARAAAEKTITPGMPEILRRAAAEGAVLLKNDGLLPLENNET
VALFGRVQSEWFYTGYGSGGDVNKPYAVNLIEGIRGCSALQLYEPLAKLYSDWSEKNPID
HGIWGYWPRFYPEMPVTKELAADAAAKADCAVVTIGRSSGEDRENALEKGSFYLTDDERT
LLETVTEAFEKTVVLLNVGSIMDLSWLHDFGDKIGAVLLVWQGGMESGNAVADLLCGAVC
PSGKLTDTIARQYSDYPSADDFGAAEFNNYTEDIFVGYRWFETFKPETVLYPFGYGLSYT
DFSVQFTGQKEEKDGFALTCSVTNTGEKHSGKTVVQIYVEPPCGVLGTPARVLCGFQKTK
LLAPGETQDLTVSIPKTRLASYDESGETGYQSAYVLQAGAYSFYLGENVRDAVRVAETRF
EKTELLEQLEQAAAPVNAFTVCKAKEENGARVLSCEPVYLSKVDLKQRILDTLPEAVEMT
GDRGIKLCDVRDGKATMDDFVAQLDLTELEAISRGAYIMNSPLGVPGNAGVYGGVLPSLR
EKGVPPVTTTDGPSGIRLYSCCSLLPIGTLLACTFDEALVEEVYKAVGAEMREKGTDVLL
GPGINIHRNPLCGRNFEYYSEDPLVTGKIAAAAVRGLQSNGVSACVKHFACNNQEFRRST
NDSRLSERALREIYLKGFEICVKEAAPQNIMTSYNKINGVHGHYQYELCTTILRGEWHYD
GCVMTDWWMRSQKSPEFPNLCDNAYRVRAQVDVLMPGGKRVGKQKPDKTLLKTYGKKDGI
TLGEMQRTAKNVLRFCMQSTAMDRFLQNQEK

Enzyme Prediction     

EC	3.2.1.21	3.2.1.58	3.2.1.37	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	542	756	5.8e-65	0.9675925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	1.62e-50	496	756	2	279	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	6.06e-36	44	278	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
PRK15098	PRK15098	2.56e-35	37	421	388	763	beta-glucosidase BglX.
pfam00933	Glyco_hydro_3	2.60e-25	543	727	65	255	Glycosyl hydrolase family 3 N terminal domain.
pfam14310	Fn3-like	3.57e-17	334	406	2	68	Fibronectin type III-like domain. This domain has a fibronectin type III-like structure. It is often found in association with pfam00933 and pfam01915. Its function is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQX17210.1	7.76e-298	12	795	6	794
VEP40216.1	1.18e-297	12	795	18	806
QKJ18913.1	7.74e-296	14	797	20	804
ACZ21868.1	2.36e-294	14	797	19	809
AZS42860.1	2.36e-294	25	793	33	802

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5WUG_A	1.18e-234	31	804	35	827	Expression,characterization and crystal structure of a novel beta-glucosidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii],5WVP_A Expression, characterization and crystal structure of a novel beta-glucosidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii]
2X40_A	2.44e-56	529	757	37	263	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	2.88e-55	529	757	37	263	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
7MS2_A	1.25e-48	539	727	32	232	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
3AC0_A	1.68e-43	539	727	33	226	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P15885	1.89e-210	34	810	8	776	Beta-glucosidase OS=Ruminococcus albus OX=1264 PE=3 SV=1
P16084	1.92e-146	34	728	30	771	Beta-glucosidase A OS=Butyrivibrio fibrisolvens OX=831 GN=bglA PE=3 SV=1
Q5BFG8	2.95e-49	541	793	40	283	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
P14002	6.84e-48	539	727	32	232	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
B0Y8M8	4.06e-45	493	760	10	257	Probable beta-glucosidase J OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglJ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003752_01693.