CAZyme Information: MGYG000003755_00118

Basic Information

• Species: Arcanobacterium_A urinimassiliense
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Actinomycetaceae; Arcanobacterium_A; Arcanobacterium_A urinimassiliense
• CAZyme ID: MGYG000003755_00118
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
321	MGYG000003755_13|CGC1	35437.84	8.8096

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003755	1072433	MAG	Canada	North America

• Gene Location: Start: 4725; End: 5690 Strand: +

Full Sequence      

MGLDSSSQSDSQQLSAKVYAVIISYHPDIKLQKLANSLCRQCQKVFVIDNGSSPASAELF
FELEELPNLEVQRLGENTGIAHAQNVGIKAALAAGADFVLLSDQDSLPTENFVAQLLSFY
QKRTASSASPLGAVGPYIKDVRPGGDELVYVDKKWGPRRFLPDTTSQAKPAVTIDAAFLL
ASGCLIPRATLEKVGLMNSDYFIDHVDLEWCLRARRAGYRLEVCPSALLDHSLGDSTVHI
PGRTQPVHVHSPIRCYYLARNTLKLIASGLLPRRWQLGYLIWLVKYCAFNTLLADKRCER
ARLLGRGIRDGLRGKKGKIEI

Enzyme Prediction     

No EC number prediction in MGYG000003755_00118.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02526	GT2_RfbF_like	1.28e-81	20	266	1	237	RfbF is a putative dTDP-rhamnosyl transferase. Shigella flexneri RfbF protein is a putative dTDP-rhamnosyl transferase. dTDP rhamnosyl transferases of Shigella flexneri add rhamnose sugars to N-acetyl-glucosamine in the O-antigen tetrasaccharide repeat. Lipopolysaccharide O antigens are important virulence determinants for many bacteria. The variations of sugar composition, the sequence of the sugars and the linkages in the O antigen provide structural diversity of the O antigen.
TIGR01556	rhamnosyltran	1.51e-58	23	311	1	281	L-rhamnosyltransferase. This model subfamily is comprised of gamma proteobacteria whose proteins function as L-rhamnosyltransferases in the synthesis of their respective surface polysaccharides. Rhamnolipids are glycolipids containing mono- or di- L-rhamnose molecules. Rhamnolipid synthesis occurs by sequential glycosyltransferase reactions involving two distinct rhamnosyltransferase enzymes. In P.aeruginosa, the synthesis of mono-rhamnolipids is catalyzed by rhamnosyltransferase 1, and proceeds by a glycosyltransfer reaction catalyzed by rhamnosyltransferase 2 to yield di-rhamnolipids. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
COG1216	GT2	2.22e-41	17	313	4	298	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd04185	GT_2_like_b	4.27e-26	20	263	1	200	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd04186	GT_2_like_c	3.63e-25	21	231	2	164	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEI12934.1	1.53e-112	18	317	4	302
AJC69134.1	1.67e-109	17	317	2	292
ALD74738.1	1.73e-109	17	317	3	293
AHU89472.1	2.37e-109	17	317	2	292
AWA43445.1	2.83e-109	17	317	28	318

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37782	3.44e-35	14	314	1	287	dTDP-rhamnosyl transferase RfbF OS=Shigella flexneri OX=623 GN=rfbF PE=3 SV=2
Q5HCN1	3.10e-06	34	228	66	248	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain COL) OX=93062 GN=icaA PE=3 SV=1
Q6G608	3.10e-06	34	228	66	248	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MSSA476) OX=282459 GN=icaA PE=3 SV=1
Q6GDD8	3.10e-06	34	228	66	248	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=icaA PE=3 SV=1
Q7A351	3.10e-06	34	228	66	248	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain N315) OX=158879 GN=icaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003755_00118.