CAZyme Information: MGYG000003761_00819

Basic Information

• Species: Stenotrophomonas maltophilia_S
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Xanthomonadales; Xanthomonadaceae; Stenotrophomonas; Stenotrophomonas maltophilia_S
• CAZyme ID: MGYG000003761_00819
• CAZy Family: CBM50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
566	MGYG000003761_15|CGC1	61444.47	7.5303

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003761	4722963	MAG	Canada	North America

• Gene Location: Start: 28429; End: 30129 Strand: +

Full Sequence      

MGSCSCTPALPGLQTVTVVRSLSFAMRLSGALLCALFLLPAIAGAQDWNYRVRSGDTLWD
LGGLYLKPSVRWQQLQQHNRIDNPYQLPPGQLLRFPISWLRTEPAPARVLSVRGKVELAG
ADGTATRALQAGEQLHIGDTVETEGDSSITLEFADASRLQLREYSRLRLDQLSRYGHTGM
VDTRLRLQQGRASNRVTPARGPASRYIIDAPTATSSVRGTVFRVSAGDTGHVGATEVLQG
KVQVGNPHGQRLVRPGQATRSSSADAAPAAVSALLPAPALRNDELRLAPLPTVLAWEPVN
GADHYRVEVVQAATPEILLFAATTADTRLAIGDLPPGQLRILLRAVDAQGIEGLDASADF
ELSDQPPPPLTVSPLHGQTINSDRPRFRWSQAPGARSSVLQIAAEPSFRQPLQEQATHAT
DLRLAQPLPPGQYYWRVASRDGEGHQGRYGQALPLQLSNEPVDPALQPPEAAHGELTLRW
QAGSEGQRYRVQVDRRGDFKTPLVDETVAEPQVSFKRPWSGTLHVRVQYIDDDGHAGEFS
PAQQIPLPCRLCYSAGGGALLLWLLL

Enzyme Prediction     

No EC number prediction in MGYG000003761_00819.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4254	COG4254	1.85e-29	43	410	1	339	Uncharacterized conserved protein, contains LysM and FecR domains [General function prediction only].
pfam04773	FecR	1.53e-15	139	243	1	96	FecR protein. FecR is involved in regulation of iron dicitrate transport. In the absence of citrate FecR inactivates FecI. FecR is probably a sensor that recognizes iron dicitrate in the periplasm.
NF033165	lipo_LipL45	6.54e-12	102	244	36	173	lipoprotein LipL45. Members of this family are lipoprotein LipL45, as described in Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130 but found broadly in the genus Leptospira. Close homologs that are not lipoproteins by sequence are likely defective in their reported coding region.
cd00118	LysM	8.73e-08	50	94	3	44	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
pfam01476	LysM	9.61e-07	50	96	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDL28994.1	0.0	1	566	1	566
ARZ75452.1	0.0	1	566	1	566
AUI08530.1	0.0	1	566	1	566
QNG88311.1	0.0	1	566	1	566
QNG92621.1	0.0	1	566	1	566

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.416973	0.568121	0.008225	0.004443	0.001124	0.001103

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003761_00819.