CAZyme Information: MGYG000003761_02843

Basic Information

• Species: Stenotrophomonas maltophilia_S
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Xanthomonadales; Xanthomonadaceae; Stenotrophomonas; Stenotrophomonas maltophilia_S
• CAZyme ID: MGYG000003761_02843
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
307	MGYG000003761_120|CGC1	32217.69	10.1948

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003761	4722963	MAG	Canada	North America

• Gene Location: Start: 1752; End: 2675 Strand: +

Full Sequence      

MKGILGTTAIIIAALTAAPASAGTLFKCQGADGVTSYVSKRVAGARCSAISYSRDIRPAP
RPVVAAPKPAPTTVASIERNPVAVAASAAAPAAVLPSAPAPAAVPTPPVASRSGRMVSGQ
VYSFMKDGVRHYTSARPTQVANLGPVRTIRYSFMERCYACGVNPRVDFGSVRLNTTAFQT
EITSAAREFGVDEAVVRAIIHAESAYNPTALSRAGAQGLMQLMPPTAARFGVSDSYDAGQ
NIRGGVQYLAWLLKRFNGDLTLAAAGYNAGEGAVDRHGGVPPYSETQYYVRRVGQLAERY
RTALSHQ

Enzyme Prediction     

No EC number prediction in MGYG000003761_02843.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	194	300	3.6e-29	0.7925925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00254	LT-like	2.42e-45	193	293	1	106	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	1.51e-42	176	293	4	142	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd16896	LT_Slt70-like	3.85e-40	178	293	4	140	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	3.21e-31	185	276	4	101	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd13403	MLTF-like	9.15e-30	182	274	1	99	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEM50682.1	1.47e-194	1	307	1	307
QDL27527.1	8.96e-194	1	307	1	299
AUI06967.1	5.70e-192	1	307	1	307
QNG91724.1	1.53e-190	1	307	1	301
QNG86395.1	1.53e-190	1	307	1	301

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	2.34e-12	178	300	416	555	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	2.35e-12	178	300	420	559	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	2.36e-12	178	300	426	565	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	2.37e-12	178	300	430	569	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	2.38e-12	178	300	436	575	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	1.47e-34	128	293	17	175	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O31976	3.69e-27	150	293	1397	1537	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	3.69e-27	150	293	1397	1537	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
P27380	1.90e-11	182	270	11	98	Transglycosylase OS=Enterobacteria phage PRD1 OX=10658 GN=VII PE=1 SV=3
A8ZWR8	2.65e-11	178	274	286	388	Membrane-bound lytic murein transglycosylase F OS=Desulfococcus oleovorans (strain DSM 6200 / JCM 39069 / Hxd3) OX=96561 GN=mltF PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000273	0.999067	0.000180	0.000147	0.000141	0.000136

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003761_02843.