CAZyme Information: MGYG000003761_03971

Basic Information

• Species: Stenotrophomonas maltophilia_S
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Xanthomonadales; Xanthomonadaceae; Stenotrophomonas; Stenotrophomonas maltophilia_S
• CAZyme ID: MGYG000003761_03971
• CAZy Family: GT2
• CAZyme Description: Glucans biosynthesis glucosyltransferase H

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
641	MGYG000003761_252|CGC1	70244.74	9.3075

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003761	4722963	MAG	Canada	North America

• Gene Location: Start: 844; End: 2769 Strand: +

Full Sequence      

MGVQTIHAEAETPRLDAGWALLPAESPLPMPEQTLREGALKVRRHRTSPRLIGLRRLYIF
GGTLGMTAVATRMMWRVLSANGISVLEACLLVLFVGLFAWIALSFASALAGFLTAVFDRG
YRLGIDPDKPLPAVHSRTALLMPTYNEDPRRLLAGLQAIYESVAATGQLDRFDFFVLSDT
RREDIAAAEEQVFAELRERVPDGQTRLFYRRRGDNSGRKAGNIADWVRRFGGAYPQMLIL
DADSLMTGDSIVRLVAGMEHNADVGLIQTLPSVIGGRTLFARMQQFGGRVYGPVIARGVA
WWHGAESNYWGHNAIIRTRAFADHAGLPALPGRKPFGGHVLSHDFVEAALMRRGGWAAHM
VPYLGGSYEEGPPTLTDLLVRDRRWCQGNLQHGKVVGSRGLHWISRTHMLIGIGHYFTAP
MWAMLMLIGIAIPLFQEGIDFNALLHLSPSVYWRAQDEEQVVRLFAATMAVLLLPKVLGY
LAMLLDPVDRRGCGGTIRAFVSMLVETVLAALMAPVVMYVQSRGVAEVLSGRDSGWDAQQ
RDDGGISWMALIRGYGGLGVFGAFMGVLAWAVSPSLAAWMAPVVIGMVLAVPVVALTSLR
GPGAFLHRLGLLDIPEENIPPPVLVRAAQLRREAAEQPPLY

Enzyme Prediction     

No EC number prediction in MGYG000003761_03971.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2943	MdoH	0.0	5	634	7	642	Membrane glycosyltransferase [Cell wall/membrane/envelope biogenesis, Carbohydrate transport and metabolism].
PRK05454	PRK05454	0.0	16	613	4	600	glucans biosynthesis glucosyltransferase MdoH.
cd04191	Glucan_BSP_MdoH	9.57e-148	138	392	1	254	Glucan_BSP_MdoH catalyzes the elongation of beta-1,2 polyglucose chains of glucan. Periplasmic Glucan Biosynthesis protein MdoH is a glucosyltransferase that catalyzes the elongation of beta-1,2 polyglucose chains of glucan, requiring a beta-glucoside as a primer and UDP-glucose as a substrate. Glucans are composed of 5 to 10 units of glucose forming a highly branched structure, where beta-1,2-linked glucose constitutes a linear backbone to which branches are attached by beta-1,6 linkages. In Escherichia coli, glucans are located in the periplasmic space, functioning as regulator of osmolarity. It is synthesized at a maximum when cells are grown in a medium with low osmolarity. It has been shown to span the cytoplasmic membrane.
cd06421	CESA_CelA_like	2.06e-18	143	392	8	233	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
cd06423	CESA_like	1.81e-15	140	326	1	171	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDL29582.1	0.0	1	641	1	641
QCZ98500.1	0.0	1	641	1	641
AYA92038.1	0.0	1	641	1	641
AEM52889.1	0.0	1	641	1	641
QNA96935.1	0.0	1	641	1	641

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B0RNI5	0.0	15	640	20	644	Glucans biosynthesis glucosyltransferase H OS=Xanthomonas campestris pv. campestris (strain B100) OX=509169 GN=opgH PE=3 SV=1
Q3BXV7	0.0	15	640	20	644	Glucans biosynthesis glucosyltransferase H OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) OX=316273 GN=opgH PE=3 SV=1
Q2NYU0	0.0	15	640	20	644	Glucans biosynthesis glucosyltransferase H OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) OX=342109 GN=opgH PE=3 SV=1
Q4UYZ8	0.0	15	640	20	644	Glucans biosynthesis glucosyltransferase H OS=Xanthomonas campestris pv. campestris (strain 8004) OX=314565 GN=opgH PE=3 SV=1
Q8PPR7	0.0	15	640	20	644	Glucans biosynthesis glucosyltransferase H OS=Xanthomonas axonopodis pv. citri (strain 306) OX=190486 GN=opgH PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999677	0.000296	0.000011	0.000000	0.000001	0.000005

TMHMM  Annotations     

start	end
53	75
90	112
413	435
462	484
497	519
550	572
577	599