CAZyme Information: MGYG000003765_00079

Basic Information

• Species: Prevotella bergensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella bergensis
• CAZyme ID: MGYG000003765_00079
• CAZy Family: CE1
• CAZyme Description: 1,4-alpha-glucan branching enzyme GlgB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
363	MGYG000003765_5|CGC1	40505.2	6.7394

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003765	2329044	MAG	Canada	North America

• Gene Location: Start: 9999; End: 11090 Strand: -

Full Sequence      

MALFATMAISGQAQSFNRVPTPNDTLQSVRQLTNGDVLFSIYAPQAKTVGITGDIMPWDR
QPRVVKNDNGVWTITVSDVKAGAYRYAFLVDGVRVYDPKAPMAHETSAVASLPQNGSEFF
QMKDVPHGAVAQRYYHSKATHSTRRLHVWTPAGYEKSDEALPVFYLIHGGGDTDNAWPTV
GCAGHILDNLLAEGKIKPMVVVMPNGSIEGADLYAEVPLFEKDLMGSIIPFIESNYRVLT
DKDHRALAGLSMGGLETLETFMAHPDMFAYINVMSSGWWQEQKQLFEQGDQRLKEIAPVL
NKSVRHLLFTQGGPEDIAYKNGLAMLEVFKKHGVKYDFSEMPGGHTWHVWRHDLCNFAQK
LFK

Enzyme Prediction     

No EC number prediction in MGYG000003765_00079.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	137	357	7.5e-52	0.960352422907489

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2382	Fes	4.43e-43	75	363	14	297	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
cd11294	E_set_Esterase_like_N	1.49e-27	35	126	1	83	N-terminal Early set domain associated with the catalytic domain of putative esterases. E or "early" set domains are associated with the catalytic domain of esterase at the N-terminal end. Esterases catalyze the hydrolysis of organic esters to release an alcohol or thiol and acid. The term esterase can be applied to enzymes that hydrolyze carboxylate, phosphate and sulphate esters, but is more often restricted to the first class of substrate. The N-terminal domain of esterase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
pfam00756	Esterase	1.77e-22	137	354	1	239	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG2819	YbbA	1.19e-12	137	345	16	242	Predicted hydrolase of the alpha/beta superfamily [General function prediction only].
cd02858	E_set_Esterase_N	2.64e-12	35	102	1	64	N-terminal Early set domain associated with the catalytic domain of esterase. E or "early" set domains are associated with the catalytic domain of esterase at the N-terminal end. Esterases catalyze the hydrolysis of organic esters to release an alcohol or thiol and acid. The term esterase can be applied to enzymes that hydrolyze carboxylate, phosphate and sulphate esters, but is more often restricted to the first class of substrate. The N-terminal domain of esterase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT68477.1	1.69e-165	2	363	9	371
AWV97131.1	3.98e-127	32	363	31	370
QVY66165.1	1.03e-110	22	363	283	630
QWG01378.1	1.09e-103	26	363	22	365
ADB37306.1	1.31e-95	12	363	17	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RZN_A	3.38e-70	32	363	28	386	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium],6RZN_B Crystal structure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]
7B5V_A	2.78e-65	32	363	43	386	ChainA, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B5V_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_A Chain A, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836],7B6B_B Chain B, Carbohydrate Esterase family 1 protein with an N-terminal carbohydrate binding module family 48 [Dysgonomonas mossii DSM 22836]
6MOU_A	9.77e-47	10	363	17	380	ChainA, Isoamylase N-terminal domain protein [Bacteroides intestinalis DSM 17393],6MOU_B Chain B, Isoamylase N-terminal domain protein [Bacteroides intestinalis DSM 17393]
6MOT_A	3.18e-46	37	363	27	359	ChainA, Isoamylase N-terminal domain protein [Bacteroides intestinalis DSM 17393]
6RZO_A	9.86e-43	22	363	6	344	Crystalstructure of the N-terminal carbohydrate binding module family 48 and ferulic acid esterase from the multi-enzyme CE1-GH62-GH10 [uncultured bacterium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P31471	2.71e-49	20	363	30	389	Uncharacterized protein YieL OS=Escherichia coli (strain K12) OX=83333 GN=yieL PE=4 SV=3
P10478	2.78e-38	106	359	25	274	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3
D5EXZ4	2.53e-37	35	363	335	670	Carbohydrate acetyl esterase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=axe1-6A PE=1 SV=1
D5EY13	1.13e-36	19	363	383	726	Endo-1,4-beta-xylanase/feruloyl esterase OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) OX=264731 GN=xyn10D-fae1A PE=1 SV=1
P9WM38	2.61e-09	146	269	190	312	Esterase MT1326 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT1326 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.199438	0.799227	0.000381	0.000413	0.000260	0.000249

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003765_00079.