CAZyme Information: MGYG000003765_00180

Basic Information

• Species: Prevotella bergensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella bergensis
• CAZyme ID: MGYG000003765_00180
• CAZy Family: GH63
• CAZyme Description: Glucosidase YgjK

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
637	MGYG000003765_11|CGC1	72619.81	6.8594

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003765	2329044	MAG	Canada	North America

• Gene Location: Start: 1140; End: 3053 Strand: -

Full Sequence      

MKINKHKIKTVCTLVLLILSSKVTMLADGYECSDFENIINIRLTPNGNERLTGCFSDQGA
WMGFTIPEAGKPVGGFCGPFSINSRKWIAKSVIALKDRHGIYQVTGSNYSPGKIVMTLQD
GDSRVEEQLIFADSRTALLNLCTYDMDTLRLQALEPGKGVKMGVEGRHVVIHGLPEETIM
LTFPVGTKLSTDGTNYMAVMTGNIKDATIAISMLLPGDRIPVQKLFAEQMTEQFEQVERA
GRERWNGYINKILRQDMPVEYNRVAVKAITTLISNWRVQRGGLLHDGIVPSHAIGYFVGC
WAWDCWRFSAAMAHFFPSLAKDNIRVMFDYQQADGMVIDCIYTDPKENNARDSKPPLACW
AVDEIWKATADTAFVREMYPKLLAYYKWWYKKRDHDGNGICEFGSTDGTLEAAAWESGMD
NAIRFDGARMLKNGENAWSINQESVDLNGYLAYEYTILKKFSKILNEKFEEPDMRGRIAD
YFFDTKNGYFFDRRLTDGSFVREAGCEGYLPFWTKIATQQQWKMAKKTLEDKTKFSTYIP
FPTIAADNPKYDPNGYWRGPIWLDQTYYAIEGFRNYGEHAKADMYTRQVFDRLEGLTADA
PIYENYDTFTGKGLQASHFSWSAAHLLMLYRSYGEKR

Enzyme Prediction     

No EC number prediction in MGYG000003765_00180.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	228	633	1.9e-101	0.49473684210526314

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10137	PRK10137	4.51e-123	33	633	30	783	alpha-glucosidase; Provisional
COG3408	GDB1	3.68e-17	205	630	207	603	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam01204	Trehalase	1.34e-10	333	634	149	509	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
pfam03200	Glyco_hydro_63	4.04e-07	372	629	185	492	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
PLN02567	PLN02567	3.14e-05	348	499	193	389	alpha,alpha-trehalase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNT67704.1	9.83e-267	34	635	28	626
ADY37311.1	3.91e-252	34	635	35	638
QUT89313.1	4.50e-252	35	635	35	642
ALJ59646.1	3.42e-249	35	635	35	642
QJR62245.1	3.43e-247	34	635	36	644

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W7S_A	1.37e-77	31	637	1	760	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7X_A	7.08e-77	31	637	1	760	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3W7W_A	9.83e-77	31	637	1	760	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3D3I_A	2.61e-73	31	637	2	761	Crystalstructural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12],3D3I_B Crystal structural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12]
7PQQ_B	2.46e-40	31	406	327	769	ChainB, Anti-RON nanobody,Megabody 91,Glucosidase YgjK [Lama glama]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42592	5.87e-78	7	637	2	783	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1
D8QTR2	3.21e-21	301	627	98	482	Mannosylglycerate hydrolase MGH1 OS=Selaginella moellendorffii OX=88036 GN=MGH PE=1 SV=1
D8T3S4	7.62e-21	301	627	98	482	Mannosylglycerate hydrolase MGH2 OS=Selaginella moellendorffii OX=88036 GN=SELMODRAFT_447962 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000370	0.998829	0.000264	0.000179	0.000171	0.000167

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003765_00180.