CAZyme Information: MGYG000003765_01550

Basic Information

• Species: Prevotella bergensis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella bergensis
• CAZyme ID: MGYG000003765_01550
• CAZy Family: GH35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
789		89204.97	7.8954

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003765	2329044	MAG	Canada	North America

• Gene Location: Start: 570; End: 2939 Strand: -

Full Sequence      

MKLLKRISTLLFFLLLTLCPITGKTTAAPGDFTVGKGMFLLNNRPFVVKAAELHYPRIPR
AYWDHRIKMCKALGMNTICLYVFWNIHEQREGEFDFSDNSDVAAFCRLAQKNGMYIIVRP
GPYVCAEWEMGGLPWWLLKKKDIRLRELDPYFMERVEIFEQKVAEQLAPLTIQNGGPIIM
VQVENEYGSYGEDKKYVGQIRDVLRKYWYTNGRGPALFQCDWASNFEKNGLDDLIWTMNF
GTGANIDAQFKRLGELRPDAPKMCSEFWSGWFDKWGARHETRPTKDMVAGIDEMLSKGIS
FSLYMTHGGTSFGHWAGANSPGFAPDVTSYDYDAPINEYGQVTPKFWELRKMMEKYNDGK
RMPAVPKAPMPLVSFPKVTLTQAKTMRQLATRQVKSRDVKTFEEMDMGWGSAFYTTTLPE
ISQPSLLTLNDAHDHAQIFINSEYIGKIDRVRNEKTLMLPAVKAGSQLTILVEAMGRINF
GRAIKDFKGITRNVTISTQAGGHELTYDLKDWTIDLMPDEADTILSRLKLPHNDIALATD
VKNGSRYPGAYVGTFNLRKVGDTFINMENFGKGQVYVNGHALGRFWRIGPQQTLYCPGAW
LKKGKNEIVVLDVVGTDNPTLWGQDRPELDKLQLEKSNKHNNIGDKPDLNSMTPVFAGAM
KGGSGWQTVRFDKSARGRYLAIEIASNQDGKDVSAVAELYLQNTDGQRISREPWTTKYAD
SESDMGNHTGDKVFDLQESTYWQTIPGSGFPHLLVIDLGSQQTVSALDYLPRAEQGAPGS
IKDVRIFMY

Enzyme Prediction     

No EC number prediction in MGYG000003765_01550.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	39	354	2.1e-115	0.993485342019544

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01301	Glyco_hydro_35	1.02e-158	39	353	2	315	Glycosyl hydrolases family 35.
PLN03059	PLN03059	2.27e-49	39	617	37	717	beta-galactosidase; Provisional
COG1874	GanA	5.38e-40	39	616	8	593	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
pfam02449	Glyco_hydro_42	3.01e-10	55	193	3	149	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.
pfam00754	F5_F8_type_C	4.69e-04	721	786	5	68	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGB27610.1	0.0	1	789	1	797
BCS84536.1	0.0	1	789	1	779
QVJ81893.1	0.0	30	789	22	787
VEH15027.1	0.0	7	789	7	784
ADE83089.1	0.0	14	789	6	787

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EON_A	2.35e-307	11	788	5	772	GalactanaseBT0290 [Bacteroides thetaiotaomicron VPI-5482]
3D3A_A	1.32e-246	30	645	6	605	Crystalstructure of a beta-galactosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4MAD_A	9.08e-139	39	613	24	578	ChainA, Beta-galactosidase [Niallia circulans],4MAD_B Chain B, Beta-galactosidase [Niallia circulans]
3WF3_A	1.68e-122	31	621	34	634	Crystalstructure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_B Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_C Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_D Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF4_A Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_B Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_C Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_D Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens]
3THC_A	1.70e-122	31	621	10	610	Crystalstructure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_B Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_C Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_D Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THD_A Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_B Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_C Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_D Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P16278	8.30e-123	11	621	11	633	Beta-galactosidase OS=Homo sapiens OX=9606 GN=GLB1 PE=1 SV=2
Q5R7P4	2.89e-119	6	621	7	633	Beta-galactosidase OS=Pongo abelii OX=9601 GN=GLB1 PE=2 SV=1
P23780	3.47e-119	39	613	42	623	Beta-galactosidase OS=Mus musculus OX=10090 GN=Glb1 PE=1 SV=1
Q60HF6	3.82e-117	15	634	15	649	Beta-galactosidase OS=Macaca fascicularis OX=9541 GN=GLB1 PE=2 SV=1
Q9TRY9	4.83e-113	23	613	24	622	Beta-galactosidase OS=Canis lupus familiaris OX=9615 GN=GLB1 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000437	0.997496	0.001509	0.000210	0.000172	0.000154

TMHMM  Annotations     

start	end
7	29